(data stored in ACNUC7421 zone)

EMBL: CP001630.PE489

CP001630.PE489       Location/Qualifiers
FT   CDS_pept        535700..536551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0496"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   mes:Meso_2208 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34463"
FT                   /db_xref="GOA:C6WI12"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI12"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACU34463.1"
FT                   /translation="MQVTGLRFRPLDYERHSQCETVRVAEVIEIDDPDDPRLDDFRDLS
FT                   TADRRPDRPGGRGLVIAEGVVVVERLLASPYPVRAVLGVRRRVEALGELPAPAYVASAD
FT                   VMARVVGFHLNRGVLAAADRAPQPSLDELATGRRLAVLEGVGDHENLGALFRNAAALGI
FT                   DGVVLGPGCSDPLYRRSVRVSMGHVLRVPFAAVDDWPGGLKLLQDKGFVVAALTPRVGS
FT                   VELPDAGLRGRRVAVLLGSEGPGLTEEAIGAADVAVRIPMSPGVDSLNVATAAAVAFYA
FT                   IA"
     atgcaggtta caggcttgcg attccgccct ctggactacg agcgacactc gcagtgcgag        60
     actgtccggg tggccgaggt gatcgagatc gacgacccgg acgacccccg gctggacgac       120
     ttccgggacc tgtcgaccgc tgaccgccgc cccgaccggc cgggtgggcg cgggctggtc       180
     atcgccgagg gcgtcgtggt ggtggagcgg ctgctggcgt ccccgtaccc ggtgcgcgcg       240
     gtgctcggcg tgcggcggcg ggtggaggcg ctgggcgagc tgcccgcgcc cgcctacgtg       300
     gcctcggccg acgtgatggc gcgggtggtg ggcttccacc tcaaccgggg cgtgctcgcc       360
     gccgccgacc gcgcgccgca gccctcgctg gacgagttgg ccaccgggcg gcggctggcc       420
     gtgctggagg gcgtcggcga ccacgagaac ctgggtgcgc tgttccgcaa cgccgccgcg       480
     ctcggcatcg acggggtggt gctggggccg gggtgcagcg acccgctgta ccggcgcagc       540
     gtccgggtgt cgatggggca cgtgctgcgg gtgccgttcg ccgcggtgga cgactggccg       600
     ggtggactga agttgttgca ggacaaggga ttcgtcgtcg ccgcgctcac ccccagggtc       660
     ggctcggttg agctgccgga cgccgggctg cgcgggcggc gggtcgccgt gctgctcggc       720
     tcggaggggc cggggctcac cgaggaggcg atcggcgcgg ccgacgtggc ggtgcgcatc       780
     cccatgtcgc cgggcgtcga ctcgctgaac gtggccaccg ccgccgctgt cgccttctac       840
     gcgatcgcct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page