(data stored in ACNUC7421 zone)

EMBL: CP001630.PE49

CP001630.PE49        Location/Qualifiers
FT   CDS_pept        52353..54134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0049"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   bbt:BBta_2852 putative gamma- glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34023"
FT                   /db_xref="GOA:C6WCK2"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCK2"
FT                   /inference="protein motif:PRIAM:2.3.2.2"
FT                   /protein_id="ACU34023.1"
FT                   /translation="MFTTRPELAGTHGMVASTHWLASSAGMAVLEDGGNAFDAAVAAGF
FT                   VLQVVEPHLNGPGGEVPALFSVRGGAPRVLCGQGTAPAAATPAHYRDLGLDLVPGSGLL
FT                   AATVPGAWDGWLTLLRDHGTKSLREVLGHAIGYARDGFPLLARVPVTIAAVADLFRDHW
FT                   TTSADLWLPGGKPPVAGERFRNPKLADTWEWLLAAGEAAGADREAQIEAARRAWSQGFV
FT                   AAQVEEFCRTAHRDDSGRDHAGVLTGQDMAGWEASYEEPVTADFGDWTVAKIGAWSQGP
FT                   ALLQQLRLLEGFADRLEYVDGAPTAETVHLAVECAKLAFADREAWYGDSADVPLEALLS
FT                   REYAAERRALVGERASLELRPGAPGGAEAVLAQHIRRGPSVAEELGGAVGEPTVSRTGA
FT                   VRGDTVHVDVVDRWGNIVSATPSGGWLQSSPTIPSLGFCLGSRAQMFWLDEGLPNSLAP
FT                   GKRPRITLSPSLALRGGEAVLAFGTPGGDQQDQWQLGFWLAHAVGGMNLQEAIDSPMWH
FT                   SNAFPSSFYPRAWTPGELVVESRAHGLDELRERGHSVVDAGPWALGRMSAVSRDPRSGL
FT                   LRAGANARGAQGYAVGR"
     gtgttcacca cgcgccctga actagcggga acccacggca tggtcgcgtc cacccactgg        60
     ctggccagct ccgcgggcat ggcggtgctg gaggacggcg gcaacgcctt cgacgccgcc       120
     gtcgcggcgg gcttcgtcct ccaggtcgtc gagccgcacc tcaacggacc gggcggcgag       180
     gtcccggccc tcttctcggt caggggcgga gcaccgcgcg tgctgtgcgg ccagggcacc       240
     gcccccgccg ccgcgacccc ggcccactac cgcgacctcg gcctcgacct ggtccccggc       300
     agcggcctgc tcgccgcgac cgtccccggc gcgtgggacg gctggctcac cctcctgcgc       360
     gaccacggca cgaagtcgct gcgcgaggtg ctcggccacg ccatcggcta cgcccgcgac       420
     ggcttcccgc tgctcgcgcg cgtgcccgtc accatcgccg ccgtcgccga cctgttccgc       480
     gaccactgga ccacctccgc cgacctgtgg ctgcccggcg ggaagccgcc cgtcgcgggc       540
     gagcggttcc gcaaccccaa gctcgccgac acctgggagt ggctgctggc cgccggtgag       600
     gccgcgggcg ccgaccggga ggcccagatc gaggccgccc gccgcgcctg gtcccagggc       660
     ttcgtggccg cccaggtcga ggagttctgc cgcaccgccc accgcgacga ctccggccgc       720
     gaccacgcgg gcgtgctcac cggccaggac atggcgggct gggaggcgag ctacgaggag       780
     ccggtcaccg ccgactttgg cgactggacc gtggcgaaga tcggcgcctg gtcgcagggg       840
     cccgcgctgc tccagcagct gcgcctgctg gagggcttcg ccgaccggct ggagtacgtc       900
     gacggcgcgc ccaccgccga gaccgtccac ctggcggtgg agtgcgcgaa gctggcgttc       960
     gccgaccgcg aggcctggta cggcgacagc gcggacgtgc cgctggaggc gctgctgtcg      1020
     cgggagtacg cggccgagcg gcgcgcgctg gtcggcgagc gggcgtcgct ggagctgcgg      1080
     cccggcgcgc ccggcggggc ggaagccgtg ctggcgcagc acatccggcg cgggccctcg      1140
     gtcgccgagg agctcggcgg cgcggtcggt gagcccacgg tgtccaggac cggggcggtg      1200
     cgcggcgaca ccgtgcacgt ggacgtggtc gaccgctggg gcaacatcgt ctcggccacc      1260
     ccgtccggcg gctggctcca gtcctcgccc acgatcccgt cgctcgggtt ctgcctgggc      1320
     agccgggcgc agatgttctg gctggacgag gggctgccga actcgctggc gcccggcaag      1380
     cggccgagga tcacgctgtc cccgtcgctg gcgctgcgcg gcggcgaggc ggtgctggcg      1440
     ttcggcacgc ccggcggcga ccagcaggac cagtggcagc tcgggttctg gctggcgcac      1500
     gcggtcggcg ggatgaacct gcaggaggcc atcgactcgc cgatgtggca ctcgaacgcg      1560
     ttccccagct ccttctaccc gagggcgtgg acgccgggcg agctggtcgt ggagtcgcgg      1620
     gcgcacgggc tggacgagct gcgcgagcgc ggccactcgg tggtggacgc cgggccgtgg      1680
     gcgctggggc ggatgtcggc ggtgtcgcgg gacccgagga gcgggctgct cagggccggg      1740
     gcgaacgcgc gcggcgcgca ggggtacgcg gtcgggcggt ag                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page