(data stored in ACNUC7421 zone)

EMBL: CP001630.PE490

CP001630.PE490       Location/Qualifiers
FT   CDS_pept        536593..537243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34464"
FT                   /db_xref="GOA:C6WI13"
FT                   /db_xref="InterPro:IPR024244"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI13"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34464.1"
FT                   /translation="MELRVQEGRAVLAGHDGAEEREVDPRSLPLGAGLADALHEWAKVA
FT                   EAVLRADSASEAPAGELVTRRGRQLAVRLAADMGTSVEFTDPVTGESQRVEAPSPEEEA
FT                   RGRHAATSTATGLSAVPGVGQHASVVDEPTPWGTGLTVTVFTAAVVAVTVVSLSLGLNE
FT                   TSGWLAVLANALVVGGISPSVWLGRKVPVWRWVSYGVVVGVVAAWVALLAALL"
     gtggaactgc gggtccagga aggcagggcc gtgctcgccg ggcacgacgg ggccgaggag        60
     cgcgaggtcg acccgcgctc cctgccgctc ggcgcggggc tggccgacgc gctgcacgag       120
     tgggcgaagg tcgccgaggc cgtgctgcgg gcggacagcg cctccgaggc gcccgccggg       180
     gagctggtga cgcggcgcgg gcggcagctg gccgtccggc tggcggcgga catgggcacc       240
     tcggtggagt tcaccgatcc ggtgacgggc gagtcccagc gggtggaggc gccgtccccg       300
     gaggaggagg cgcggggcag gcacgcggcg acctcgacgg ccaccgggct gtcggcggtc       360
     cccggcgtcg gccagcacgc ctcggtggtg gacgagccga ccccgtgggg caccgggctg       420
     accgtcacgg tcttcacggc ggccgtggtc gcggtgaccg tggtgtcgct gtcgctcggg       480
     ctcaacgaga ccagcgggtg gctggccgtg ctggcgaacg cgctcgtggt cgggggcatc       540
     tcgccgtcgg tgtggctggg gcggaaggtc ccggtgtggc ggtgggtgtc ctacggcgtg       600
     gtggtcgggg tggtcgccgc ctgggtggcg ttgctggcgg cgctgctcta g                651
//

If you have problems or comments...

PBIL Back to PBIL home page