(data stored in ACNUC7421 zone)

EMBL: CP001630.PE491

CP001630.PE491       Location/Qualifiers
FT   CDS_pept        537256..538983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0498"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; dienelactone hydrolase;
FT                   phospholipase/Carboxylesterase; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34465"
FT                   /db_xref="GOA:C6WI14"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI14"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACU34465.1"
FT                   /translation="MELTAELVVSGLRVGGPAVSPDGRSVVFAARGVGDGAEERPEGLR
FT                   WCGEPAELVFRVGGQLCAVGASGPARVLADLPEGVRWHLPLASGEVALAVPGLGGASRL
FT                   SLLDPVSGVSRAVDLGDRHVAEAAQRPGGGPLAVLTWEGPGYDPGLLRPRLHLVELEGL
FT                   AVRDLGPVAAGAEGLAWWRSGDRWRLAHLALTPPGLQAGMAVFDAEVPESGAIVEHVNR
FT                   TAGMAACPLELVQVERGAPLVLVAAGLDTEVHRLGADGLTLLARHEARVERLAADGAGE
FT                   VVAAVVSRADAPPDVCSGPVGGDLTRVSDSRPELRGIRWGERRRLSCVAVDGVELDGLL
FT                   VLPPGKAEADGPFPMVVLPHGGPYDRHADGFALDWHPSAQWLAHAGFAALLPNPRGGSG
FT                   RGHEFAAAVAGRAGHEELGDLLALLDHVVGLGVADPERVGIAGWSHGGYLAAWAVATTD
FT                   RFAAALVGAGVSDWGRQGAEGEWGAFDAALACGEAEEHDPVARAGGIRVPVLVVHGAED
FT                   VNVPVSQAELLRDALVEHGVEHELVVYEGEGHVIEGVEQQVDLLERTREWFTRWLGVR"
     gtggagctga ctgcggagct ggtggtgtcg gggctgcggg tcggtggacc cgcggtctcg        60
     ccggacggcc ggtcggtcgt gttcgcggcc cgaggggtcg gcgacggggc cgaggagcgg       120
     ccggaggggc tgcgctggtg cggcgagccc gccgagctgg tgttccgggt gggcgggcag       180
     ctgtgcgcgg tcggggccag cgggcccgcg cgggtgctgg ccgacctgcc ggagggggtg       240
     cggtggcacc tgccgctggc gtccggcgag gtggcgctgg ccgtgccggg gctcggtggg       300
     gcgtcgcggc tcagcctgct cgacccggtg agcggggtgt cgcgggcggt ggacctgggg       360
     gaccggcacg tcgcggaggc ggcgcagcgg cccggcgggg ggccgttggc ggtgctgacc       420
     tgggaggggc cggggtacga ccctggcttg ttgcggccga ggttgcacct ggtcgagctg       480
     gaggggttgg cggtccgcga cctggggccg gtggcggcgg gcgccgaggg cctggcgtgg       540
     tggcggtcgg gcgaccggtg gcggttggcg cacctggcgc tgacgccgcc ggggttgcag       600
     gccgggatgg cggtgttcga cgcggaggtc cccgagagcg gggcgatcgt cgagcacgtg       660
     aaccggacgg cgggaatggc ggcgtgcccg ctggagctgg tgcaggtgga gcgcggggcg       720
     ccgctggtgc tggtcgcggc cgggttggac accgaggtgc accggctggg cgcggacggg       780
     ctgacgctgc tggcgcggca cgaggcgcgg gtggagcggc tggcggcgga cggggcgggg       840
     gaggtcgtcg cggcggtggt gagccgggcg gacgctcccc cggacgtgtg ctccgggccg       900
     gtgggcgggg atctcacccg agtgagtgac agcaggccgg agttgcgcgg gatccgctgg       960
     ggggagcggc ggcggttgtc gtgcgtcgcg gtggacgggg tggagctgga cgggttgctg      1020
     gtgctgccgc cggggaaggc ggaggcggac gggccgttcc cgatggtggt gctgccgcac      1080
     ggggggcctt acgaccggca cgcggacggg ttcgcgctgg actggcaccc gtcggcgcag      1140
     tggttggcgc acgcggggtt cgcggcgctg ctgcccaacc cgcgcggggg gagcgggcgg      1200
     gggcacgagt tcgctgcggc ggtcgcgggg cgggcggggc atgaggagtt gggggatttg      1260
     ttggcgctgc tggaccacgt ggtggggctg ggggtggcgg acccggagcg ggtggggata      1320
     gccgggtgga gccacggggg gtacttggcg gcctgggcgg tggcgaccac ggatcgcttc      1380
     gcggcggcgc tcgtgggggc gggtgtgagt gattgggggc ggcagggggc tgagggggag      1440
     tggggggcgt tcgacgccgc cttggcctgc ggggaggcgg aggagcacga cccggtggcg      1500
     cgggccgggg ggattcgggt tccggtgctg gtggtgcacg gggctgagga tgtgaacgtg      1560
     cctgtgtcgc aggcggagtt gttgcgggat gcgttggtcg agcacggggt tgagcacgag      1620
     ctggtggtgt acgaggggga ggggcatgtg atcgaggggg tggagcagca ggttgatctg      1680
     ctggagcgga ctcgggagtg gttcacgcgg tggttggggg tgcggtga                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page