(data stored in ACNUC7421 zone)

EMBL: CP001630.PE492

CP001630.PE492       Location/Qualifiers
FT   CDS_pept        complement(539369..540679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0499"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: lpp:lpp1608
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34466"
FT                   /db_xref="GOA:C6WI15"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI15"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34466.1"
FT                   /translation="MRRLLGKIAIDTRPLGIPAYRRLWVSTIVTAVGSQLTAVAVPKQV
FT                   YDITGSSAWVGVAAGVALVPLLVFGLYGGAVADVVDRRKLLLVTNTGIAVTSVLLWVQA
FT                   AVGMSSVWPVIALLGLQQVFFAANAPARTASIARLVPPEMIPAATSLGATVMTFGGVFG
FT                   PMAAGALMPVLGLPTLYLIDAVALTATIWAVWKLPPLPPLNAPSRHAGLRDVVDGFKYL
FT                   AVQKVLLASFLLDIIAMVFGMPRALFPEMAEQTFGDPPGGGWALGWLFAAMPLGGLLCG
FT                   LLSGWTSRISRHGAGVVLAVIAWGLFMLGFGLSNALWLAVLFLALGGAADIVSMVFRNA
FT                   ILQTAASDDMRGRMQGVFIVVVAGGPRLADLAHGTTGALIGPGPASAVGGVLVVIATVA
FT                   AAFLLPVVWRYRFTPEQLGPPAGKAGPAGPVGPAGKV"
     gtgaggcgtt tgctggggaa gatcgcgatc gacaccaggc cgctgggaat cccggcctac        60
     cgcaggttgt gggtgtcgac catcgtcacc gccgtgggca gtcagctgac cgcggtcgcg       120
     gtgcccaagc aggtgtacga catcaccggg tcgtcggcct gggtgggcgt cgcggcgggc       180
     gtggcgctgg tgccgctgct ggtgttcggc ctgtacggcg gggccgtggc cgacgtggtc       240
     gaccggcgga agctgctgct ggtgaccaac acgggcatcg cggtgacgtc ggtgctgctg       300
     tgggtgcagg cggccgtggg gatgtcgtcg gtgtggccgg tgatcgcgct gctgggcctg       360
     cagcaggtgt tcttcgccgc gaacgcgccc gcgcgcaccg cgtcgatcgc caggctggtg       420
     ccaccggaga tgatcccggc ggcgacctcg ctgggcgcga cggtgatgac gttcggcggc       480
     gtgttcggcc cgatggcggc aggcgccctg atgcccgtgc tcggcctgcc gaccctgtac       540
     ctgatcgacg ccgtggccct gaccgcgacg atctgggccg tctggaagct ccccccgctg       600
     ccgcccctga acgccccgtc ccgccacgcg ggcctgcgcg acgtggtcga cggcttcaag       660
     tacctggccg tgcagaaggt gctgctggcg tcgttcctgc tggacatcat cgcgatggtg       720
     ttcgggatgc cgagggcgct gttcccggag atggcggagc agaccttcgg cgacccgccg       780
     ggcggcggct gggcgctggg ctggctgttc gcggcgatgc ccctgggcgg cctgctgtgc       840
     gggcttctgt cggggtggac gtcgcggatc agcaggcacg gcgcgggcgt ggtcctggcg       900
     gtgatcgcgt ggggcctgtt catgctgggc ttcggcctgt cgaacgccct gtggctggcc       960
     gtgctgttcc tggccctggg cggcgcggcc gacatcgtga gcatggtgtt ccgcaacgcg      1020
     atcctgcaga cggcggcgag cgacgacatg cgcggccgga tgcagggcgt gttcatcgtc      1080
     gtggtggcag gcggcccccg cctggccgac ctggcgcacg gcacgacggg cgccctgatc      1140
     ggcccaggcc cggcgtcggc ggtgggcggc gtgctggtgg tgatcgccac ggtggccgcg      1200
     gccttcctgc tcccggtggt ctggcgctac cgcttcaccc cggagcagct ggggccgccg      1260
     gcgggcaagg caggaccggc ggggccggta ggcccggcgg gcaaggtctg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page