(data stored in ACNUC7421 zone)

EMBL: CP001630.PE493

CP001630.PE493       Location/Qualifiers
FT   CDS_pept        540751..542352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0500"
FT                   /product="polysaccharide lyase family 8"
FT                   /note="PFAM: polysaccharide lyase family 8; polysaccharide
FT                   lyase 8 alpha-helical; KEGG: vvy:VVA1636 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34467"
FT                   /db_xref="GOA:C6WI16"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI16"
FT                   /inference="protein motif:PFAM:PF02278"
FT                   /protein_id="ACU34467.1"
FT                   /translation="MSDLDVVRARLRPPHQPGPGLPPLPDGTWADIDYADHDAADFPPL
FT                   EHLRRALSLPDGQRLKALEAWRRLAPRSDNWWYNEIGAPRLVGDALLGADLDRAQRATW
FT                   GTWLAEQAGPVPMTGQNLVWAQGIELRRGLVEDDPELVRRAVARMSEVLRTGDGEGIQE
FT                   DLSFHQHGPQLYSGGYGASLVADLALWVRAVHGTPWAFGAAEVRLLADFLVDGQQWAVH
FT                   GGGFDFTTMGREIARADAHHRTADLRAAVLRLLECDPPRTAELTAFDDRLAGHGAPLVG
FT                   TRWYPRSDYLVHRRPGWSLSVRMSSGRTVPTECLNGENLLGRHLGDGVAALRLGDQAED
FT                   GYRSVLPVWDWARLPGVTTEQGRSLRPRPDQPRGGGEAIGWSDGENGVAALRLAGVEGF
FT                   TEGWKTWFCFADAVVALGAGITAPDAVGPVVTTIDQRLADHGSVTYVPMTTGHFSGVER
FT                   RTGSWRDLSGVESGRPVEADVFVMGFDHGPRPENASYACLIAPGDELPEVEVLANRVDR
FT                   QAVRCGSVVLERSMAG"
     atgagcgacc tcgacgtcgt ccgggcccgc ctgcgcccgc cgcaccaacc cggacccggc        60
     ctccccccgc tgcccgacgg cacctgggcc gacatcgact acgccgacca cgacgccgcc       120
     gacttcccgc cgctggagca cctccgccgc gccctgtcgt tacccgacgg ccaacgcctc       180
     aaagcgctcg aggcgtggcg caggctggcc ccccgcagcg acaactggtg gtacaacgag       240
     atcggcgcgc cccggctcgt cggcgacgcc ctcctcggcg ccgacctcga ccgcgcccag       300
     cgcgccacct ggggcacctg gctcgccgag caagccggtc cggtgccgat gaccgggcag       360
     aacctggtgt gggcgcaggg gatcgagctg cgccggggcc tcgtcgagga cgacccggag       420
     ctggtccgcc gcgcggtcgc ccgcatgtcc gaggtgctgc gcaccggcga cggcgagggc       480
     atccaggagg acctgagctt ccaccagcac ggcccccagc tgtactccgg cggctacggc       540
     gcctcgctgg tcgccgacct cgccctgtgg gtgcgcgcgg tgcacggcac gccgtgggcg       600
     ttcggcgccg ccgaggtgcg cctgctcgcc gacttcctgg tggacggcca gcagtgggcc       660
     gtgcacggcg gcggcttcga cttcaccacc atggggcgcg agatcgcccg cgccgacgcc       720
     caccaccgca ccgccgacct gcgcgccgcc gtgctgcgcc tgctggagtg cgacccgccg       780
     cgcaccgccg agctgaccgc gttcgacgac cgcctcgcgg gccacggcgc gccgctggtc       840
     ggcacccgct ggtaccccag gtccgactac ctggtgcacc gcagacccgg ctggtcgctg       900
     tccgtgcgga tgtcctcggg ccggacggtg cccaccgagt gcctgaacgg ggagaacctg       960
     ctgggccgcc acctcggcga cggggtcgcc gcgctgcgcc tgggcgacca ggccgaggac      1020
     ggctaccgct cggtgctgcc ggtgtgggac tgggcgcggc tgccgggcgt caccaccgag      1080
     cagggccggt cgctgcggcc ccggcccgac cagccgcgcg gcggcggcga ggcgatcggg      1140
     tggtcggacg gggagaacgg cgtcgccgcg ctgcggctgg cgggcgtgga ggggttcacc      1200
     gagggctgga agacgtggtt ctgcttcgcc gacgcggtcg tggcgctggg cgcgggcatc      1260
     accgcgccgg acgcggtcgg gccggtggtc accacgatcg accagcggct cgcggaccac      1320
     ggcagcgtca cgtacgtgcc gatgacgacc gggcacttct ccggcgtgga gcggcggacc      1380
     ggcagctggc gggacctgtc cggggtggag agcgggcgtc cggtggaggc cgacgtgttc      1440
     gtgatgggct tcgaccacgg tccccggccg gagaacgcct cgtacgcctg cctcatcgcg      1500
     cccggcgacg agctgcccga ggtggaggtg ctggcgaacc gggtggaccg gcaggcggtg      1560
     cggtgcggct cggtggtgct ggagcgctcc atggccggtt ga                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page