(data stored in ACNUC7421 zone)

EMBL: CP001630.PE494

CP001630.PE494       Location/Qualifiers
FT   CDS_pept        complement(542596..543255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0501"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="KEGG: rpi:Rpic_0717 pyridoxamine 5'-phosphate
FT                   oxidase; TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34468"
FT                   /db_xref="GOA:C6WI17"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI17"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ACU34468.1"
FT                   /translation="MSEATTSITLPAMRVSYERSALGEGDLAATWHEQLQLWLDEATNA
FT                   GLLEPNAMVLATADPSGRPSSRTVLAKGLDERGLVFFTNYTSAKSHDLMATRYASTTFP
FT                   WYGLQRQAHVRGTVEKVSHAETTEYWESRPRGSQLGAWASPQSRVVTGRPTLESALNKI
FT                   ERQFTDTERVPVPPHWGGWRIRPEEVEFWQGRQDRMHDRLRFRLGRDGWETERVAP"
     atgtcggaag ccacgaccag catcacgctg ccggctatgc gagtgtccta cgagcggagc        60
     gcgctgggcg agggcgacct ggccgccacc tggcacgagc agctgcagct gtggctggac       120
     gaggcgacca acgcgggcct gctggagccc aacgcgatgg tgctggccac cgccgacccg       180
     agcgggcggc cgtcgtcgcg gaccgtgctg gcgaagggcc tggacgagcg cggcctggtg       240
     ttcttcacca actacacctc ggccaagtcg cacgacctga tggccaccag gtacgcctcc       300
     accacgttcc cctggtacgg cctgcagcgg caggcgcacg tgcggggcac cgtggagaag       360
     gtcagccacg cggagaccac cgagtactgg gagagccgcc cgaggggctc ccagctgggc       420
     gcctgggcct cgccgcagtc acgggtggtg accggtcggc ccaccctgga gtccgcgctc       480
     aacaagatcg agcgccagtt caccgacacc gagcgggtcc cggtgccgcc gcactggggc       540
     ggctggcgca tccggcccga ggaggtcgag ttctggcagg gccgccagga ccggatgcac       600
     gaccgcctgc gcttccgcct cggccgggac ggctgggaga ccgagcgcgt ggccccctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page