(data stored in ACNUC7421 zone)

EMBL: CP001630.PE495

CP001630.PE495       Location/Qualifiers
FT   CDS_pept        complement(543312..544157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0502"
FT                   /product="urease accessory protein UreD"
FT                   /note="KEGG: scl:sce6547 urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34469"
FT                   /db_xref="GOA:C6WI18"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI18"
FT                   /inference="similar to AA sequence:KEGG:sce6547"
FT                   /protein_id="ACU34469.1"
FT                   /translation="MKAFARLVAERNPNGRTVIREMRSATPLTLVPARGARSDAHALVH
FT                   LVSSITAPLGGDELELRITVGPGAALVLRGVAATVALPGHRPGGSRSRVLLEVAEGGSV
FT                   EHLPEPTVVTARADHEAVLEAELAEGARLRAREVLVLGRLGERPGRLTTTTSVRRGGPL
FT                   LRQSLTIGDERGGPDTVDTSPAGLAGRRVIGAEVLCWGEDPAGPVSGDWWSLVPLARGG
FT                   SLATALGDTVIEVERALTGACGSHPGSSELLTRSRARFRADGHTLRVRSHRPGGSAQDR
FT                   "
     gtgaaggcat ttgcacggct ggtcgcggaa agaaacccga atggccgcac ggtgatccgc        60
     gaaatgcggt ctgcgacgcc gttgacgctg gtcccggcac gcggcgcgcg ttcggacgcg       120
     cacgcgctgg tgcatctggt cagttcgatc accgcgccgc tcgggggtga cgagctcgaa       180
     ttgcggataa ccgtgggacc gggcgcggcg ctcgtgctgc gcggggtcgc cgcgacggtg       240
     gcgcttccgg gtcaccggcc gggcggcagc cggtcgcggg tgctgctgga ggtggcggag       300
     ggcggcagcg tcgagcacct gccggagccg acggtggtga ccgcgcgggc cgaccacgag       360
     gcggtgctgg aggcggagct ggccgagggc gcgcggctgc gggcgcggga ggtgctcgtg       420
     ctggggcggc tgggcgagcg gccgggcagg ctcaccacga ccacgtcggt gcggcgcggc       480
     ggaccgctgc tgcggcagtc cctcacgatc ggggacgagc ggggcggacc ggacacagtg       540
     gacaccagcc ccgccgggct cgcgggcaga cgggtgatcg gcgcggaggt gctgtgctgg       600
     ggcgaggacc cggcggggcc ggtgtcgggc gactggtggt cgctggtccc gctggcgcgc       660
     ggcgggagcc tggcgaccgc gttgggggac accgtgatcg aggtcgaacg cgctctcacc       720
     ggagcgtgtg gcagccatcc cggttcgagt gagctgctga ctcgatctcg tgcacgattc       780
     cgtgcagacg gtcacacgct ccgtgtccgt tctcaccgtc cgggcggttc cgcgcaggac       840
     cgataa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page