(data stored in ACNUC7421 zone)

EMBL: CP001630.PE496

CP001630.PE496       Location/Qualifiers
FT   CDS_pept        544235..544771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34470"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34470.1"
FT                   /translation="MSRTTTALVATAAILAAGGAAGASASAGASPEPVAAAASVPTCRS
FT                   AGLDIAFGEVQGTAGTTYREIALVNRGLRPCALRGFPGVSYVDQQGDQVGPAAERVGGP
FT                   GEVLVLPRGGTATADVGFVRVGNFDPEVCHPVPVWGVRVFPPDGTEPLYLPLDGEHGCA
FT                   DARVGSHLTVASVRS"
     atgagtagaa ccaccaccgc gctcgtcgcc acggccgcga tcctggcggc agggggcgcg        60
     gcaggcgcct cggcctcggc gggcgcctcc ccggagccgg tcgcggcggc ggcctcggtc       120
     cccacctgcc gctccgccgg gctcgacatc gccttcggcg aggtgcaggg gacggcgggc       180
     accacctacc gcgagatcgc cctggtcaac cgagggctgc gcccgtgcgc gctgcgcggg       240
     ttccccggcg tgtcctacgt ggaccagcag ggcgaccagg tcggcccggc cgccgagcgg       300
     gtcggcggcc ccggcgaggt gctcgtgctg ccgcgcggtg gcacggccac ggcggacgtc       360
     ggcttcgtcc gggtcggcaa cttcgacccg gaggtctgcc accccgttcc ggtgtggggc       420
     gtgcgggtgt tcccgcccga cgggaccgag ccgctctacc tgccgctcga cggcgagcac       480
     gggtgcgccg acgcccgcgt cggctctcac ctcaccgtgg ccagcgtgcg cagctga          537
//

If you have problems or comments...

PBIL Back to PBIL home page