(data stored in ACNUC7421 zone)

EMBL: CP001630.PE497

CP001630.PE497       Location/Qualifiers
FT   CDS_pept        complement(544741..545454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0504"
FT                   /product="urease accessory protein UreG"
FT                   /note="TIGRFAM: urease accessory protein UreG; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: scl:sce6551 urease
FT                   accessory protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34471"
FT                   /db_xref="GOA:C6WI20"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI20"
FT                   /inference="protein motif:TFAM:TIGR00101"
FT                   /protein_id="ACU34471.1"
FT                   /translation="MSADHGHGHGHAHPVNFDPTDAGHDPHVPAPDARRAVRIGIGGPV
FT                   GSGKTALTAALCRALGGRVDLAVVTNDIYTTEDADFLRRAGVLPTERIEAVQTGACPHT
FT                   AIRDDITANLDAVEELEQRFPGLELVIIESGGDNLTAVFSRGLADAQVFVVDVAGGDKV
FT                   PRKGGPGVTTADLLVINKTDLAPLVGADLGVMTADAHRMRGELPVIAQSLVETPDAPAV
FT                   AEWVLGQLRTLATVR"
     ttgtcagctg accacgggca cggccacggc cacgcccacc cggtgaactt cgacccgacc        60
     gacgcggggc acgacccgca cgtcccggcg cccgacgccc gcagggcggt gcgcatcggc       120
     atcggcggcc cggtgggcag cggcaagacc gcgctgaccg ccgcgctgtg ccgcgcgctc       180
     ggcgggcggg tcgacctggc cgtggtgacc aacgacatct acaccaccga ggacgccgac       240
     ttcctgcgca gggcgggcgt gctgccgacc gagcggatcg aggcggtgca gaccggggcg       300
     tgcccgcaca ccgcgatccg cgacgacatc accgcgaacc tggacgcggt ggaggagctg       360
     gagcagcggt tccccggact ggagctggtg atcatcgaga gcggcgggga caacctgacg       420
     gcggtgttca gccggggtct ggccgacgcg caggtgttcg tggtggacgt ggcgggcggc       480
     gacaaggtgc cgcgcaaggg cgggccgggg gtgaccaccg cggacctgct ggtgatcaac       540
     aagaccgacc tggccccgct cgtgggcgcc gacctcggtg tcatgacggc cgacgcccac       600
     cggatgcgcg gggagctgcc ggtgatcgcc caatcgctgg tcgagactcc ggacgccccc       660
     gcggtggcgg agtgggtgct gggtcagctg cgcacgctgg ccacggtgag gtga             714
//

If you have problems or comments...

PBIL Back to PBIL home page