(data stored in ACNUC7421 zone)

EMBL: CP001630.PE498

CP001630.PE498       Location/Qualifiers
FT   CDS_pept        complement(545444..546106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34472"
FT                   /db_xref="GOA:C6WI21"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI21"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0974"
FT                   /protein_id="ACU34472.1"
FT                   /translation="MELAALLLVDSRFPGGGHAHSGGLEEAVSRRLVTDEATLRGFLLG
FT                   RLRTAGALAAVFAAAAARAPDLAALLELDVELDARTPSPAQRRASRAQGRGIARAARRA
FT                   WPSERLEELLRAEPRPHHPVLTGLLVGDPGDAARVIAYQSASGPATAAIRLLGLDPFGV
FT                   NAVLAGLADDLGAVVADAVARAADPPAGLPAPGSTGLDLMAEAHDRHHQEEVRLFVS"
     gtggagctgg ccgcgctgct gctggtggac tcgcgcttcc ccggaggcgg gcacgcgcac        60
     tccggcgggc tggaggaggc ggtgtcgcgg cggctggtga ccgacgaggc gacgctgcgc       120
     gggttcctgc tgggcaggct gcgcacggcg ggcgcgctcg ccgcggtgtt cgccgccgcc       180
     gcggcccgcg cacccgacct ggcggccctg ctggagctgg acgtcgagct ggacgcccgc       240
     acgccgtcac ccgcgcagcg cagggcctcc cgcgcgcagg ggagggggat cgcccgcgcg       300
     gcgcggcggg cgtggccgtc ggagcggctg gaggagctgc tgcgcgccga accgcgcccg       360
     caccacccgg tgctcaccgg gctgctggtg ggcgaccccg gcgacgcggc gcgggtcatc       420
     gcctaccagt cggcgtccgg cccggcgacg gccgcgatcc ggctgctcgg cctggacccg       480
     ttcggcgtca acgccgtgct cgcgggcctg gcggacgacc tcggcgcggt ggtggcggac       540
     gccgtggccc gcgccgccga cccgcccgcc gggctgccgg cgcccggctc gaccggcctc       600
     gacctcatgg ccgaggcgca cgaccgccac caccaggaag aggtgcgtct ctttgtcagc       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page