(data stored in ACNUC7421 zone)

EMBL: CP001630.PE499

CP001630.PE499       Location/Qualifiers
FT   CDS_pept        complement(546215..547912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0506"
FT                   /product="urease, alpha subunit"
FT                   /note="TIGRFAM: urease, alpha subunit; PFAM:
FT                   amidohydrolase; Urease alpha-subunit domain protein; KEGG:
FT                   ank:AnaeK_0975 urease, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34473"
FT                   /db_xref="GOA:C6WI22"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI22"
FT                   /inference="protein motif:TFAM:TIGR01792"
FT                   /protein_id="ACU34473.1"
FT                   /translation="MTRVDRERYAELLGPTTGDRVRLADTDLLITVTDDLCRGAGSGDE
FT                   VIFGGGKVIRESMGQGMATRAEGAPDLVITGAVVLDHWGVVKADVGVRDGRITAIGKAG
FT                   NPDVMDGVHPDLVIGPSTEVLSGNGKILTAGGVDCHVHFICPQIVDTALASGLTTLIGG
FT                   GTGPAEGTKATTVTPGAWNLGRMLAAMDHMPVNVLLLGKGNTAREDALREQLLGGAGGF
FT                   KLHEDWGTTPVAIDTALRIADESGVQVAIHTDTLNEAGFLESTLDAIAGRSINAYHSEG
FT                   AGGGHAPDIIQVVSEPNVLPSSTNPTRPHTVNTLEEHLDMLMVCHHLNPSVPEDLAFAE
FT                   SRIRPTTIAAEDVLHDLGAISMISSDSQAMGRVGEVITRTWQTAHVMHGRRGELAENLR
FT                   ARRYVAKYTINPAIAHGIDHEVGSVEAGKLADLVLWEPKFFGVRPSVVLKGGFIAWAAM
FT                   GDANASIPTPQPVLARPMFGAHAAARGSVHFVSQQAVDADLADLLRLSRPLVPVRGTRA
FT                   VGKADMVLNDALPHVRVDPDSFAVTVDGELVEPEPVERLPMAQRYFLF"
     gtgacccgcg tcgaccgcga gcggtacgcg gagctgctcg gccccaccac cggcgaccgg        60
     gtgcggctgg ccgacaccga cctgctgatc acggtgaccg acgacctgtg ccggggcgcg       120
     ggctccggcg acgaggtgat cttcggcggc ggcaaggtga tccgcgagtc catgggccag       180
     gggatggcga cccgcgcgga gggcgcgccg gacctggtga tcaccggtgc ggtggtgctg       240
     gaccactggg gcgtggtgaa ggccgacgtg ggcgtgcggg acggccggat caccgcgatc       300
     ggcaaggcgg gcaacccgga cgtgatggac ggggtgcacc cggacctggt gatcggcccg       360
     tccacggagg tgctgtccgg caacgggaag atcctcacgg cgggcggggt cgactgccac       420
     gtgcacttca tctgcccgca gatcgtggac accgcgctgg cgtccggcct gaccacgctg       480
     atcggcggcg gcacgggacc ggccgagggc accaaggcca ccacggtcac gcccggcgcg       540
     tggaacctcg gccggatgct ggccgcgatg gaccacatgc cggtgaacgt cctgctgctg       600
     ggcaagggga acaccgcccg cgaggacgcg ctgcgcgagc agctgctcgg cggcgcgggc       660
     gggttcaagc tgcacgagga ctggggcacc acgccggtcg cgatcgacac cgcgctgcgg       720
     atcgccgacg agtccggggt gcaggtggcg atccacacgg acacgttgaa cgaggccggt       780
     ttcctggagt ccacgctgga cgccatcgcg ggccggtcga tcaacgccta ccactcggag       840
     ggcgcgggcg gcgggcacgc gccggacatc atccaggtgg tgtccgagcc gaacgtgctg       900
     ccgtcgtcga cgaacccgac ccggccgcac accgtgaaca ccctcgaaga gcacctcgac       960
     atgctcatgg tctgccacca cctgaacccg tcggtgcccg aggacctggc gttcgcggag      1020
     agccgcatcc ggccgaccac gatcgccgcc gaggacgtgc tgcacgacct gggcgcgatc      1080
     tcgatgatca gctcggactc gcaggcgatg ggccgggtcg gcgaggtgat cacgcggacc      1140
     tggcagaccg cgcacgtgat gcacggccgt cgcggggagc tggcggagaa cctgcgggcg      1200
     cggcggtacg tcgccaagta cacgatcaac ccggcgatcg cgcacggcat cgaccacgag      1260
     gtcgggtcgg tggaggcggg caagctcgcg gacctggtgc tgtgggagcc gaagttcttc      1320
     ggggtgcggc cgtcggtggt gctcaagggc gggttcatcg cgtgggcggc gatgggggac      1380
     gcgaacgcct cgatcccgac gccgcagccg gtgctggcgc ggccgatgtt cggcgcgcac      1440
     gcggcggcgc gcggcagcgt gcacttcgtg tcgcagcagg cggtggacgc ggacctggcg      1500
     gacctgctgc ggctgtcccg gccgctggtt ccggtgcgcg gcacgcgggc ggtgggcaag      1560
     gcggacatgg tgctgaacga cgcgctgccg cacgtgcggg tggacccgga cagcttcgcg      1620
     gtgaccgtcg acggcgagct ggtcgagccg gaaccggtgg agcggttgcc gatggcgcag      1680
     cggtacttcc tgttctga                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page