(data stored in ACNUC7421 zone)

EMBL: CP001630.PE5

CP001630.PE5         Location/Qualifiers
FT   CDS_pept        6031..6462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33979"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF8"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACU33979.1"
FT                   /translation="MRSRRATGGAAARRRRRTWSGPGPDDRDPQPLGRLASRIAADRGW
FT                   AEKLRGGQVIAQWPKLVGEDVAEHAQPVSFEDGELTVQADSTAWATQLRLLQRELLKKI
FT                   AAGLGPNVVKRLKVLGPAAPSWRYGPRHVSGRGPRDTYG"
     gtgcggagca ggcgcgccac cggcggggcc gccgcgcgca ggcgcaggcg cacctggtcc        60
     ggtcccggcc cggacgaccg cgacccgcag ccgctcggca ggctcgcgtc ccggatcgcc       120
     gccgaccggg ggtgggcgga gaagctcagg ggcggccagg tcatcgcgca gtggccgaag       180
     ctggtggggg aggacgtcgc cgagcacgcg cagccggtgt cgttcgagga cggcgagctg       240
     accgtccagg ccgactcgac ggcgtgggcg acgcagctgc gactgctcca gcgggagctg       300
     ctgaagaaga tcgcggccgg gttgggcccg aacgtcgtca agcggctcaa ggtgctgggg       360
     cccgccgcgc caagctggcg ctacggcccc aggcacgttt cagggcgtgg tccgcgcgac       420
     acctacgggt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page