(data stored in ACNUC7421 zone)

EMBL: CP001630.PE50

CP001630.PE50        Location/Qualifiers
FT   CDS_pept        complement(54212..54541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34024"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCK3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34024.1"
FT                   /translation="MNLRKTVTGALLGLGSAAAMLGLGGTAMAADTIDITTTANPDIDA
FT                   HAPDAVKVGEIVDLDINEISDINLNVLDDDNVDADVFAHDLQALVNNGDLPADALVHLL
FT                   IEGND"
     atgaacctga ggaagaccgt cacgggcgcc ctgctgggcc tcggcagcgc agccgccatg        60
     ctcggcctcg gtggtaccgc gatggccgcc gacaccatcg acatcaccac caccgccaac       120
     cccgacatcg acgcccacgc gccggacgcg gtgaaggtcg gcgagatcgt ggacctcgac       180
     atcaacgaga tcagcgacat caacctgaac gtgctggacg acgacaacgt cgacgccgac       240
     gtgttcgccc acgacctcca ggcgctggtc aacaacggcg acctgcccgc cgacgcgctg       300
     gtgcacctgc tgatcgaggg caacgactga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page