(data stored in ACNUC7421 zone)

EMBL: CP001630.PE500

CP001630.PE500       Location/Qualifiers
FT   CDS_pept        complement(547909..548220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0507"
FT                   /product="urease, beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: atu:Atu2405 urease subunit beta; TIGRFAM:
FT                   urease, beta subunit; PFAM: Urease beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34474"
FT                   /db_xref="GOA:C6WI23"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI23"
FT                   /inference="protein motif:TFAM:TIGR00192"
FT                   /protein_id="ACU34474.1"
FT                   /translation="MRPGEIIPGEEPVELNPGRPRTTLVVVNGGDRPVQVGSHYHFAAV
FT                   NPGLLFDRDAAWGKRLDVPAGTAVRFEPGVEREVVLVPLAGRRVVPGLRPEHAGELDR"
     gtgcgaccag gcgagatcat ccccggcgag gagccggtcg agctgaaccc cggccgcccg        60
     aggacgaccc tggtggtggt caacgggggc gaccggccgg tgcaggtggg gtcgcactac       120
     cacttcgcgg cggtgaaccc cggcctgctg ttcgaccgcg acgcggcctg gggcaagcgg       180
     ctggacgtcc cggcgggcac ggcggtgcgg ttcgagccgg gcgtggagcg cgaggtggtg       240
     ctggtgccgc tggcgggccg ccgggtcgtg ccgggcctgc gccccgagca cgccggggag       300
     ctggaccggt ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page