(data stored in ACNUC7421 zone)

EMBL: CP001630.PE501

CP001630.PE501       Location/Qualifiers
FT   CDS_pept        complement(548279..548581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0508"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: oan:Oant_0332 urease, gamma subunit; TIGRFAM:
FT                   urease, gamma subunit; PFAM: Urease gamma subunit region"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34475"
FT                   /db_xref="GOA:C6WI24"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI24"
FT                   /inference="protein motif:TFAM:TIGR00193"
FT                   /protein_id="ACU34475.1"
FT                   /translation="MHLTPHERDKLLVHVAADVARRRLERGVALNHPESVALITSHVLE
FT                   GARDGRTVGELMASGRHVLTREQVMDGVPEMIDSVQVEATFPDGTKLVTVHDPIS"
     atgcacctga cgccgcacga gcgggacaag ctcctggtcc acgtggcggc cgacgtcgcg        60
     cgccggaggc tggagcgcgg ggtcgcgctg aaccaccccg agtcggtcgc gctgatcacc       120
     tcgcacgtgc tggagggcgc ccgcgacggg cggacggtcg gcgagctgat ggcgagcggg       180
     cggcacgtgc tgaccaggga gcaggtcatg gacggggtgc ccgagatgat cgactcggtg       240
     caggtggagg cgaccttccc ggacggcacc aagctggtga ccgtgcacga cccgatcagc       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page