(data stored in ACNUC7421 zone)

EMBL: CP001630.PE502

CP001630.PE502       Location/Qualifiers
FT   CDS_pept        548814..549929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0509"
FT                   /product="Citrate (Si)-synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="PFAM: Citrate synthase; KEGG: pzu:PHZ_c0162 citrate
FT                   synthase GltA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34476"
FT                   /db_xref="GOA:C6WI25"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI25"
FT                   /inference="protein motif:PRIAM:2.3.3.1"
FT                   /protein_id="ACU34476.1"
FT                   /translation="MVQQAEQDGFKPGLEGVVAFRTEIAEPDRDGGALRYRGVDIEELA
FT                   GRVTFGDVWALLVDGAFGAGLVPAEPFPIPVHTGDVRVDVQAALAMVAPIWGFQPLLDI
FT                   PEREARDQLARASVMALSYVAQSARGTGRPAVPQHRVDQCATITDRFLTRWRGEPDPAH
FT                   VRALDAYWVSAAEHGLNASTFTARVIASTGADVAAAMSGAIGAMSGPLHGGAPARVLPM
FT                   IEAVERKGDARGYVRGVLDRGERLMGFGHRVYRAEDPRARVLRRTCKELDAPRYEAAAA
FT                   LEQAALAELRERRPDRAIETNVEFWAAVVLDFAEVPPAIMPAMFTCARTAGWSAHILEQ
FT                   KRTGRLVRPSAAYIGPEARSVESVEGWDEIA"
     gtggtgcagc aggcggagca ggacgggttc aagccaggac tggagggcgt cgtcgccttc        60
     cgcaccgaga tcgccgagcc ggaccgcgac ggcggcgccc tgcggtaccg gggcgtcgac       120
     atcgaggagc tggccggtcg ggtcaccttc ggcgacgtgt gggcgctgct ggtcgacggc       180
     gccttcgggg cgggcctggt gcccgccgag ccgttcccca tcccggtgca caccggggac       240
     gtgcgggtgg acgtgcaggc ggcgctggcc atggtcgccc cgatctgggg gttccagccg       300
     ctgctggaca tccccgagcg ggaggcgcgc gaccagctcg cgcgggcctc cgtgatggcg       360
     ctgtcgtacg tggcgcagtc cgcgcgcggc accggcaggc ccgccgtgcc gcagcaccgg       420
     gtcgaccagt gcgcgaccat caccgaccgg ttcctcaccc gctggcgcgg cgagccggac       480
     ccggcgcacg tcagggccct ggacgcctac tgggtgtcgg ccgccgagca cggcctgaac       540
     gcctccacgt tcaccgccag ggtgatcgcc tccaccggcg cggacgtggc cgccgcgatg       600
     tccggcgcga tcggcgcgat gtccggcccg ctgcacggcg gcgcgcccgc gcgggtgctg       660
     ccgatgatcg aggcggtgga gcgcaagggc gacgcgcgcg gctacgtgcg cggcgtgctc       720
     gaccggggcg agcggctgat gggcttcggg caccgggtct accgggccga ggacccgagg       780
     gcccgcgtgc tgcgccgcac ctgcaaggag ctggacgcgc cccggtacga ggcggcggcg       840
     gcgctggagc aggccgcgct ggcggagctg cgcgagcgca ggccggaccg ggcgatcgag       900
     acgaacgtgg agttctgggc cgcggtggtc ctggacttcg ccgaggtgcc gcccgcgatc       960
     atgcccgcga tgttcacctg cgccaggacc gccgggtggt cggcgcacat cctggagcag      1020
     aagcgcaccg gcaggctggt gcgcccgtcg gcggcgtaca tcggtccgga ggcgcgctcg      1080
     gtcgagtcgg tcgagggctg ggacgagatc gcgtga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page