(data stored in ACNUC7421 zone)

EMBL: CP001630.PE503

CP001630.PE503       Location/Qualifiers
FT   CDS_pept        550082..550912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0510"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sus:Acid_0079 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34477"
FT                   /db_xref="GOA:C6WI26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI26"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34477.1"
FT                   /translation="MTAAISARGLRKSYGDFEAVRGVDLEVAEGEVFALLGPNGAGKST
FT                   TVEILEGLRPRTGGEVSVLGADPATAPRSWRAGIGVVQQAATDLADITVAEAVHHHARY
FT                   YPDPRDPDEVVALVGLADKARTRAGRLSGGQRRRLDVALGIIGRPRVLFLDEPTTGFDP
FT                   EARRQFWGLVRDLAREGATILLTTHYLDEVEALADRLAVIAGGRLVAEGTPTTVGGRDR
FT                   AKALVTWVDPDGVQRSRATTDPVALVVELNALGPVADLTVTRPTLEDVYLELIA"
     atgacagcag cgatcagcgc gcgcggcctg cgcaagtcct acggggactt cgaggccgtg        60
     cggggcgtcg acctcgaagt cgccgagggc gaggtgttcg ccctcctcgg ccccaacggc       120
     gcgggcaaga gcaccaccgt cgagatcctg gagggcctgc gcccccgcac cggcggcgag       180
     gtgtccgtcc tcggcgccga cccggccacc gcgccccgct cgtggcgcgc gggcatcggc       240
     gtcgtccagc aggccgccac cgacctggcc gacatcaccg tcgccgaggc cgtccaccac       300
     cacgcccgct actacccgga cccgcgcgac ccggacgagg tcgtcgccct cgtcggcctc       360
     gccgacaagg cccgcacccg cgcgggcagg ctgtccgggg ggcagcgccg caggctcgac       420
     gtcgccctcg gcatcatcgg ccgcccccgc gtgctgttcc tggacgagcc caccaccggc       480
     ttcgaccccg aggcccgcag gcagttctgg ggcctggtcc gcgacctcgc ccgcgagggg       540
     gccacgatcc tgctcaccac ccactacctg gacgaggtgg aggcgctcgc cgaccgcctc       600
     gccgtcatcg cgggcggcag gctcgtcgcc gagggcaccc ccaccaccgt cggcgggagg       660
     gaccgggcga aggccctggt cacctgggtc gacccggacg gtgtccagcg cagccgcgcc       720
     accaccgacc cggtcgcgct cgtcgtcgag ctgaacgccc tcggcccggt cgccgacctg       780
     accgtcaccc gccccaccct cgaagacgtc tacctggagc tgatcgcgtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page