(data stored in ACNUC7421 zone)

EMBL: CP001630.PE504

CP001630.PE504       Location/Qualifiers
FT   CDS_pept        550909..551709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0511"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mxa:MXAN_1598
FT                   ABC transporter, permease protein, ABC-2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34478"
FT                   /db_xref="GOA:C6WI27"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI27"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACU34478.1"
FT                   /translation="MRTAALGLARGGLELRQFFRNTAGFLFTFALPVFLLLLLGSIFSG
FT                   MTPSGADFTQEQEFTAGMLGAGIISTTFITLGAGIAQDRENGTLKRLHGTPLPLASYFI
FT                   GKIVMVLVLSLAEAVLVLITGVLVFDVDLPTDPARWFTFAWVFALGTVSCALLGIAVSS
FT                   VAGSARSAPTVLNLPYVGLQFVSGVFISIAVLPQWMVVLGSLFPLKWVAQGFRSVLLPE
FT                   GAAVVEVAGAWEHGRIALVLAGWCVAGLVLCAASFRWTNGRSGG"
     gtgaggaccg cagcgctcgg actcgcgcgg ggcggcctgg agctgcgcca gttcttccgc        60
     aacaccgccg ggttcctctt caccttcgcc ctgccggtgt tcctgctcct gctgctcggc       120
     tcgatcttct ccgggatgac gccgtccggc gcggacttca cccaggagca ggagttcacc       180
     gccgggatgc tcggcgcggg catcatctcc accacgttca tcaccctcgg cgccggcatc       240
     gcccaggacc gcgagaacgg caccctcaag cgcctgcacg gcaccccgct gccgctcgcc       300
     tcctacttca tcggcaagat cgtcatggtc ctggtgctca gcctcgccga ggcggtgctg       360
     gtgctgatca cgggcgtgct cgtgttcgac gtggacctgc cgaccgaccc ggcccgctgg       420
     ttcacgttcg cctgggtgtt cgcgctcggc accgtctcct gcgcgctgct gggcatcgcc       480
     gtcagctccg tcgcgggctc ggcgcgctcc gccccgaccg tgctgaacct gccctacgtg       540
     ggactccagt tcgtgtcggg tgttttcatc agcatcgcgg tcctgccgca gtggatggtc       600
     gtgctcggct cgctgttccc gctcaagtgg gtcgcgcagg ggttccgctc ggtgctgctg       660
     cccgaggggg ctgcggtcgt ggaggtggct ggggcgtggg agcacgggag gatcgcgctg       720
     gtgctggcgg gctggtgcgt cgcgggcttg gtgctgtgcg cggcctcgtt ccggtggacg       780
     aacgggcgaa gtgggggctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page