(data stored in ACNUC7421 zone)

EMBL: CP001630.PE505

CP001630.PE505       Location/Qualifiers
FT   CDS_pept        551682..552701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0512"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerization and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: sus:Acid_1273 integral membrane sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34479"
FT                   /db_xref="GOA:C6WI28"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI28"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACU34479.1"
FT                   /translation="MDERAKWGLITGAGLLVAACGALLPDVTAERHWAAVAVIAVIAAW
FT                   VLLQPRQLYLIGLHALTVTAMWLSPGATFLLFAVLPEVYRRIPLRPAFWVMLAFVVPPW
FT                   LLSWARTGDPTSMLLVLLPTALFSQLFGWVIRTLAEQNLVIAELSHEAGVAAERERLSA
FT                   EIHDTLAQGFTSIVTLVQAARADPVRADDHLDLALRTARENLAESRALVAALAPAALEG
FT                   SLADALRRQVERVADFGVRAEFAERGAGEVPRAVEVVLLRAAQEALTNARRHAARVRVE
FT                   LDVLPDSVRLTVRDDGPGYRGAPEGFGLRGMRARLEQVGGTLTRSDDDGAVLVAEAPR"
     gtggacgaac gggcgaagtg ggggctgatc accggggccg ggctgctcgt cgcggcctgc        60
     ggcgcgctcc tcccggacgt caccgcggag cggcactggg cggcggtcgc ggtgatcgcg       120
     gtgatcgccg cgtgggtgct gctccaacca cgacagctct acctgatcgg gctgcacgcg       180
     ctcacggtga cggcgatgtg gctgtcaccg ggggcgacgt tcctgctgtt cgcggtgctg       240
     cccgaggtgt accggcggat cccgctgcgc cccgccttct gggtgatgct cgcgttcgtc       300
     gtgccgccgt ggctgctctc gtgggccagg accggcgacc cgacgtcgat gctgctggtg       360
     ctgctcccga ccgcgctgtt ctcccagctg ttcggctggg tgatccgcac gctggccgag       420
     cagaacctcg tcatcgccga gctctcgcac gaggcgggcg tcgccgccga gcgggaacgg       480
     ctgtcggcgg agatccacga caccctggcg cagggcttca ccagcatcgt gaccctggtc       540
     caggcggccc gcgccgaccc ggtccgcgcc gacgaccacc tggacctggc gctgcgcacc       600
     gcgcgggaga acctggccga gtcgcgggcg ctggtggcgg cgctcgcgcc cgccgcgctg       660
     gagggctcgc tggccgacgc gctgcgcagg caggtggagc gggtggcgga cttcggcgtc       720
     cgggccgagt tcgccgagcg cggtgcgggg gaggtgccgc gcgcggtcga ggtggtgctg       780
     ctgcgcgccg cgcaggaggc gctgaccaac gcccgcaggc acgccgcccg cgtgcgcgtg       840
     gagctggacg tgctgccgga ctcggtgcgg ttgaccgtgc gcgacgacgg tccgggctac       900
     cggggcgcgc cggagggctt cggcctgcgc gggatgcggg ccaggctgga gcaggtcggc       960
     ggaacgctga cccgctcgga cgacgacggc gcggtgctcg tcgccgaggc gcccaggtga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page