(data stored in ACNUC7421 zone)

EMBL: CP001630.PE506

CP001630.PE506       Location/Qualifiers
FT   CDS_pept        552766..553395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0513"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   sus:Acid_2683 two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34480"
FT                   /db_xref="GOA:C6WI29"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI29"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU34480.1"
FT                   /translation="MDGSEAVGGPVIRVLLVDDHPVVRQGVRGMLAPATDLEVVGEAAS
FT                   GDEAVRLVRADPPDVVLMDLRMPGGDGVEATARIGALSRVVVLTTYETDADILRAVEAG
FT                   AVGYLLKDASPEDLVAAVRAAARGETVLAPSVAGRLVRRTPALSPREVEVLRLVGRGLS
FT                   NAEIGRQLFIGEATVKTHLLRVFSKLDVSDRTAAVTTAMRLGLLGH"
     atggacggct cggaagctgt gggcggcccg gtgatccggg tgctgctggt cgacgaccac        60
     ccggtggtgc ggcagggcgt gcgcgggatg ctcgcccccg ccaccgacct ggaggtggtc       120
     ggcgaggccg cgtccggcga cgaggctgtg cgcctggtcc gcgccgaccc gccggacgtc       180
     gtcctcatgg acctgcggat gcccggcggc gacggcgtcg aggccaccgc ccgcatcggc       240
     gcgctgtcca gggtggtcgt gctgaccacc tacgagaccg acgcggacat cctgcgcgcc       300
     gtggaggcgg gcgcggtcgg ctacctgctc aaggacgcgt cccccgagga cctggtggcc       360
     gccgtccgcg ccgccgcgcg cggcgagacc gtgctggccc cgtcggtggc gggcaggctg       420
     gtccgccgca ccccggcgct gtccccgcgc gaggtcgagg tgctgcggct ggtggggcgc       480
     ggcctgtcca acgcggagat cggcaggcag ctgttcatcg gcgaggcgac cgtgaagacg       540
     cacctgctcc gggtgttctc gaagctcgac gtctccgacc gcaccgccgc cgtcaccacc       600
     gccatgcgcc tgggcctgct cggccactga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page