(data stored in ACNUC7421 zone)

EMBL: CP001630.PE508

CP001630.PE508       Location/Qualifiers
FT   CDS_pept        555000..555815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34482"
FT                   /db_xref="InterPro:IPR021421"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34482.1"
FT                   /translation="MRTLRVVGLDEDGKSIVLEDPERGERFVLPADERLRAAARGDLTR
FT                   LGQIEVETESQMRPREIQARIRAGESVDQVAAIAGIPAHRVERFAYPVLLERSRIADLA
FT                   QRAHPVREDGPDVQTLGEVVAHSFGLRGQEYVDVSWDSWRGEDGRWVVQLHWTAGRSDN
FT                   RAHWAFHPGAHGGTVTALDDAAVDLMDPNPNRVRSLRAVTHLARAALDVEGRPLAEPEI
FT                   LVREERPVVEEPIVVDGELAEDQPSAKRKKNHPIVPSWEDVLLGVRSRG"
     atgcgaacgc tgcgagtggt cgggctcgac gaggacggca agtcgatcgt ccttgaggac        60
     cccgaacgcg gcgagcgctt cgtgctgccc gccgacgagc gcctgcgcgc agccgcgcgc       120
     ggcgatctca ccagactcgg ccagatcgag gtcgagaccg agagccagat gcggccccgc       180
     gagatccagg cgcgcatccg cgcgggcgag tccgtggacc aggtcgccgc catcgcgggc       240
     atccccgcgc accgggtcga gcgcttcgcc tacccggtgc tgctggagcg ctcccgcatc       300
     gccgacctgg cccagcgcgc ccacccggtg cgcgaggacg gcccggacgt gcagaccctc       360
     ggcgaggtcg tcgcgcactc cttcggcctg cgcggccagg agtacgtgga cgtcagctgg       420
     gactcctggc gcggcgagga cggccgctgg gtcgtccaac tgcactggac ggcaggccgc       480
     tcggacaacc gcgcgcactg ggccttccac cccggcgccc acggcggcac cgtcacagcc       540
     ctggacgacg cagccgtgga cctgatggac cccaacccga accgggtgcg cagcctgcgc       600
     gccgtgaccc acctggccag ggcagccctg gacgtggaag gcaggcccct ggccgagccg       660
     gaaatcctcg tccgcgaaga gcgcccggtg gtggaagagc cgatcgtggt ggacggagaa       720
     ctggccgaag accagccctc cgccaagcgc aagaagaacc acccgatcgt cccgtcctgg       780
     gaggacgtcc tgctgggagt ccgctccagg ggataa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page