(data stored in ACNUC7421 zone)

EMBL: CP001630.PE509

CP001630.PE509       Location/Qualifiers
FT   CDS_pept        556396..556770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34483"
FT                   /db_xref="GOA:C6WI32"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34483.1"
FT                   /translation="MLGRVVVGAALGAGLGAAWMWLRDRIVSGRVCTQEDWGCLELYLV
FT                   MIPVGLVAAVLISWAVFAAAHVGRPLGTAAVSVAFAAALALLTVWFEIPGDVLLTSAVG
FT                   FVLASPVTARRPVVHTAARG"
     atgcttggtc gagtggtggt cggcgccgcg ctgggcgcgg gtctcggtgc cgcgtggatg        60
     tggctgcgcg accggatcgt ctccggtcgt gtctgcaccc aggaggactg gggctgcctg       120
     gagctctacc tggtgatgat cccggtcggc ctggtggccg ccgtcctcat ctcctgggcc       180
     gtgttcgcgg cggcccacgt cggccgcccg ctgggcacgg ccgccgtcag cgtggccttc       240
     gcagccgcgc tcgccctgct caccgtgtgg ttcgagatcc caggcgacgt gctgctcacc       300
     agcgccgtcg gcttcgtgct cgcctcaccg gtgaccgcgc gccgccccgt cgtccacacc       360
     gcggcccgtg gctga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page