(data stored in ACNUC7421 zone)

EMBL: CP001630.PE51

CP001630.PE51        Location/Qualifiers
FT   CDS_pept        complement(55503..55877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34025"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34025.1"
FT                   /translation="MDLALSKVVELRESGFQFLHLRDEDGQLDRIMAFKQRRGFIDSIL
FT                   FWSETEARAGRLPAVRESSRAAQAVWIYEGPLVEAVDRLLDLPEPGTRNAPTLMRRTAS
FT                   DLAVVTTLPFTLKLPPGAIA"
     atggatctcg cactgagcaa ggtcgtcgag ctgcgcgaaa gcgggttcca gttcctccac        60
     ctccgggacg aggacgggca gctggaccgc atcatggcgt tcaagcagcg ccgaggcttc       120
     atcgactcga tcctcttctg gtcggagacc gaggcccgcg cgggcaggct gcccgccgtc       180
     cgggagagct cacgcgcagc tcaggcggtc tggatctatg aaggtccgct cgtcgaggcg       240
     gtcgaccggc tgctcgactt gcccgagccg ggaacgcgca acgcgcccac cctcatgagg       300
     cgaacggcgt ccgacctcgc ggtcgtcacg acgctgccgt tcaccctgaa gctgcccccc       360
     ggcgccatcg cgtaa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page