(data stored in ACNUC7421 zone)

EMBL: CP001630.PE510

CP001630.PE510       Location/Qualifiers
FT   CDS_pept        556763..557443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to hedgehog protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34484"
FT                   /db_xref="GOA:C6WI33"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34484.1"
FT                   /translation="MAEASRLEAGASTDSFTHRFRLRRATANPRTEDTPVSETISPRTT
FT                   TSTPPPTPTPTSTSTPTDEVTAAHSTPVDTRPRPTIRERGSRAGGFAFSALLRVVLSGV
FT                   VGAALCAAWIAAHQAGLLHRALGEASASLPDFLLLLFVGLPLALVASALLAGPLLWLLG
FT                   VRPAWPIVLLGPVVLAAAHYFDVPNLLAGTGDQWVVLAILAGLSYALAGLLTIPTMLMR
FT                   SRKS"
     gtggctgagg cgagccgcct ggaggcgggc gcttccacgg acagcttcac gcacaggttc        60
     cggttgcgcc gcgccacggc caacccccga acggaggaca ccccggtgag cgagaccatc       120
     tcgcctcgaa ccaccacgtc caccccaccc cccactccca cccccacctc cacctccacc       180
     cccaccgacg aagtcaccgc ggcccacagc accccggtag acacccgccc ccgcccgacc       240
     atccgggagc gcggctcccg agccggcggc ttcgcgttct ccgcgctgct ccgcgtagtc       300
     ctctccggcg tcgtgggcgc cgccctgtgc gcggcctgga tcgccgccca ccaggcgggc       360
     ctcctgcacc gcgccctcgg cgaggcctcc gcgtccctcc ccgacttcct gctcctgctc       420
     ttcgtcggcc tccccctggc cctggtcgcc agcgcactcc tcgcaggccc gctgctctgg       480
     ctcctcggcg tccgccccgc gtggccgatc gtgctcctcg gcccggtggt cctcgccgca       540
     gcccactact tcgacgtgcc gaacctgctg gccggaacgg gcgaccagtg ggtagtcctc       600
     gcgatcctcg cgggcctcag ctacgccctg gccggcctgc tcaccatccc cacgatgctc       660
     atgcgctccc gcaagtccta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page