(data stored in ACNUC7421 zone)

EMBL: CP001630.PE512

CP001630.PE512       Location/Qualifiers
FT   CDS_pept        557855..559624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0519"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: rce:RC1_1837
FT                   ABC transporter, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34486"
FT                   /db_xref="GOA:C6WI35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI35"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34486.1"
FT                   /translation="MNDQRTSTAATLRRLWPYLRPVKNPIAVSTGAAVLAMLCGLGIPL
FT                   VTQRVVDGPIAHRDLSALPWLIGLVLALGLAEALLFYTRRKVIARPASTVELAMRTDLY
FT                   TRLQALPVSFHDRWQSGQLLSRATSDLTTVRRFVAFVLVFLLVNTTVIVIGLGVLFWLS
FT                   PLLGLVALVSTLPLIALSYLFETRYKVAARLSQDQVGDLTTTVEESVLGIRVLKAFGRG
FT                   PHLAARFQRQARELRGTELVKVRVFAALWAALLVLPELSIAGQLAVGAFGITSGTMTAG
FT                   TLIAAIAVSAYLRWPVDSIGWLLSETNQTAAAVERYFEVLDEPVAITSPPSPKPLATPV
FT                   RGHLRFEGVRFGHPGSDDEVLRGVDLEVRPGETVALVGATGSGKTALTALVPRLADVTG
FT                   GRVTLDGVDVRELDLAELRRVVGTAFEEPVLFSASVTENVVLGGGDASPHAVREALRVA
FT                   RAEEFVDALPWGPDTRIGEQGLSLSGGQRQRLALARAVAGRPAVLVLDDPLSALDVHTE
FT                   AEVEAALRRVLRDVTALVVAHRSSTVQLADRVAVLSGGRITAIGTHRELLAGNTEYRHL
FT                   LSTLADEDEEVRV"
     gtgaacgacc aacgtacttc cacggccgcg accctgcgca ggctgtggcc ctacctgcgc        60
     cccgtcaaga acccgatagc cgtcagcacc ggggccgccg tgctcgccat gctgtgcggg       120
     ctcggcatcc cgctggtcac ccagcgggtc gtcgacggcc cgatcgcgca ccgcgacttg       180
     tccgccctcc cctggctgat cggcctcgtc ctggcgctcg gcctcgccga ggccctgctc       240
     ttctacaccc gccgcaaggt catcgcccgc cccgcctcga ccgtcgagct ggccatgcgc       300
     accgacctct acacccgcct ccaggcgctc ccggtctcct tccacgaccg ctggcagtcc       360
     gggcagctgc tctcccgcgc caccagcgac ctcaccaccg tgcgccggtt cgtcgcgttc       420
     gtgctggtgt tcctgctggt caacaccacc gtcatcgtca tcggactcgg cgtcctgttc       480
     tggctgtcgc cgctgctcgg cctggtggcg ctggtgtcca ccctgccgct gatcgccctg       540
     tcctacctgt tcgagacccg ctacaaggtc gccgcccgcc tctcccagga ccaggtcggc       600
     gacctcacca ccacggtcga ggagtccgtg ctgggcatcc gggtgctcaa ggcgttcggc       660
     cggggcccgc acctggccgc ccggttccag cgccaggccc gcgagctgcg cggcaccgag       720
     ctggtcaagg tccgggtgtt cgccgcgctg tgggccgcgc tgctggtgct gcccgagctg       780
     tccatcgcgg gccagctcgc cgtgggcgcg ttcggcatca cctccggcac gatgacggcg       840
     ggcaccctca tcgccgccat cgcggtcagc gcctacctgc gctggccggt cgactcgatc       900
     gggtggttgt tgtccgagac caaccagacc gcggcggccg tcgagcgcta cttcgaggtg       960
     ctcgacgaac cggtcgcgat cacctctccc ccctctccga aaccgctggc cacgccggtg      1020
     cgcgggcacc tgcgcttcga gggcgtccgc ttcggccacc ccggctcgga cgacgaggtg      1080
     ctgcgcggcg tcgacctgga ggtgcggccc ggcgagaccg tcgcgctggt cggcgcgacc      1140
     gggtccggca agaccgcgct gaccgcgctg gtgcccaggc tcgccgacgt caccggcggc      1200
     cgggtcaccc tggacggggt cgacgtgcgc gagctggacc tggccgagct gcgccgggtc      1260
     gtcggcaccg cgttcgagga accggtcctg ttctccgcca gcgtcaccga gaacgtcgtc      1320
     ctcggcggcg gggacgcctc gccgcacgcg gtgcgcgagg cgctgcgggt ggcgcgcgcc      1380
     gaggagttcg tcgacgccct cccgtggggc ccggacaccc gcatcggcga gcagggcctg      1440
     tcgctgtccg gcggccagcg gcagcggctc gcgctggccc gcgcggtcgc gggcagaccg      1500
     gcggtgctgg tgctggacga cccgctgtcc gcgctggacg tgcacaccga ggccgaggtg      1560
     gaggccgcgc tgcgccgcgt gctgcgcgac gtgacggcgc tggtcgtcgc gcaccggtcg      1620
     agcaccgtgc agctcgccga ccgggtggcc gtcctctccg gcggccggat caccgcgatc      1680
     ggcacgcacc gcgagctgct cgcgggcaac accgagtacc gccacctgct gtcgaccctg      1740
     gccgacgagg acgaggaggt gcgggtgtga                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page