(data stored in ACNUC7421 zone)

EMBL: CP001630.PE513

CP001630.PE513       Location/Qualifiers
FT   CDS_pept        559621..561579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0520"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: bha:BH1126
FT                   ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34487"
FT                   /db_xref="GOA:C6WI36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI36"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34487.1"
FT                   /translation="MSASTGNAEDPTGTRTGTAQDPTTPAQDPTTPAQAPTTTAQDPTT
FT                   PPPTVDGWRGVAAEEVDAPDHATGTRLRARSRRLLGSLLRPHAGLVALSLALMVVENLV
FT                   LLAGPLLIAAAIDRGVPAALDGDPTTLAWCVGGYAASGLAATVLRYAFVRLIGRIGQDV
FT                   LLDLRLRVFRHVQRLSVSFHERYTSGKVISRMTNDVDSLQNLLDEGLDGFFNAMLSVFA
FT                   ISVVLFALDVPMALFVLSGFLPLVLLVRWFQARSAAAYRGTTGSIAKVVVQLVETMNGI
FT                   RAVQAFRREPRNERIMADLNGAYRDANVTALTVVATFTSAVRAIGNISLAVLLAWGAWR
FT                   VAEGTLELGVLAAFTLYVRRFYDPMDNIAMFTNAYAAATAALEKLSGLLDERPSVPDPV
FT                   DPVPLGPVRGEVRFEGVEFRYPASDSLVLPRFDLRVPAGQTVALVGATGAGKSTLAKLV
FT                   ARFYDPTGGAVWLDGADLRSVSDADLRRAVVMVTQENFLFEGTVADNIALGRPDATREE
FT                   VVAAAVAVGAHDFIGELPDGYDTDVSKRGGRLSSGQRQLVAFARAFLADPAVLVLDEAT
FT                   SSLDVPTEWTVQSALETVLASRTAFIIAHRLSTVLIADRVLVVDGGRVVEDGTPEELIG
FT                   ERGRFARLHEAWRESLA"
     gtgagcgcct caaccggcaa cgcggaagac cccaccggga ccaggaccgg gaccgcccag        60
     gacccgacca cccccgccca ggacccgacc acccccgccc aggccccgac caccaccgcc       120
     caggacccga ccaccccgcc ccccaccgtc gacggctggc gcggcgtggc cgcagaggag       180
     gtcgacgccc ccgaccacgc caccggcacc cgcctgcgcg cccgctcccg ccgcctcctc       240
     ggctccctgc tccgccccca cgccggcctg gtcgccctct ccctcgccct gatggtcgtg       300
     gagaacctgg tcctgctcgc gggcccgctc ctgatcgccg ccgcgatcga ccggggcgtc       360
     ccggccgcgc tcgacggcga cccgaccacc ctcgcctggt gcgtcggcgg ctacgccgcg       420
     tccggcctgg ccgccaccgt cctgcgctac gcgttcgtgc ggctcatcgg ccgcatcggc       480
     caggacgtcc tgctcgacct gcgcctgcgg gtgttccggc acgtccagcg gctgtccgtg       540
     tccttccacg agcgctacac ctccggcaag gtcatctccc ggatgaccaa cgacgtcgac       600
     tcgctgcaga acctgctcga cgagggcctc gacgggttct tcaacgcgat gctgtcggtg       660
     ttcgcgatca gcgtcgtgct gttcgcgctg gacgtgccca tggcgctgtt cgtgctgtcc       720
     gggttcctgc cgctggtgct gctggtccgc tggttccagg cccgctcggc ggcggcctac       780
     cggggcacca ccggttcgat cgccaaggtc gtcgtgcagc tggtggagac catgaacggc       840
     atccgcgccg tgcaggcgtt ccgccgcgag ccgcgcaacg agcgcatcat ggccgacctg       900
     aacggcgcct accgggacgc caacgtcacc gcgctcaccg tggtcgccac gttcacctcg       960
     gccgtgcgcg ccatcggcaa catctcgctc gccgtcctgc tggcgtgggg cgcgtggcgg      1020
     gtcgcggagg gcaccctgga gctgggcgtg ctggccgcgt tcaccctcta cgtccggagg      1080
     ttctacgacc cgatggacaa catcgccatg ttcaccaacg cctacgccgc cgcgaccgcc      1140
     gcgctggaga agctgtccgg gctgctggac gagcgcccgt cggtgcccga cccggtcgac      1200
     ccggtcccgc tggggccggt gcgcggcgag gtccggttcg agggcgtcga gttccgctac      1260
     ccggcctccg actcgctcgt gctgcccagg ttcgacctgc gcgtcccggc cgggcagacc      1320
     gtggcgctgg tcggcgcgac cggcgcgggc aagtccacgc tggccaagct ggtcgcccgc      1380
     ttctacgacc cgaccggggg agcggtgtgg ctggacggcg ccgacctgcg gtcggtgtcc      1440
     gacgcggacc tgcgccgggc cgtggtgatg gtgacgcagg agaacttcct gttcgagggc      1500
     acggtcgccg acaacatcgc cctcggccgc cccgacgcca cccgcgagga ggtcgtcgcg      1560
     gcggcggtcg cggtcggcgc gcacgacttc atcggcgagc tgcccgacgg ctacgacacc      1620
     gacgtgagca agcgcggcgg ccggttgtcc tccgggcagc ggcagctggt ggcgttcgcg      1680
     cgggcgttcc tggccgaccc ggcggtgctg gtgctggacg aggccacgtc gagcctggac      1740
     gtgccgaccg agtggaccgt gcagtccgcg ctggagacgg tcctggccag ccggacggcg      1800
     ttcatcatcg cccaccggct gtccacggtc ctgatcgcgg accgggtgct ggtggtcgac      1860
     ggcggccggg tcgtggagga cgggacgccc gaggagctga tcggggagcg ggggcggttc      1920
     gcgcggttgc acgaggcgtg gcgcgaatcg ctcgcctga                             1959
//

If you have problems or comments...

PBIL Back to PBIL home page