(data stored in ACNUC7421 zone)

EMBL: CP001630.PE514

CP001630.PE514       Location/Qualifiers
FT   CDS_pept        562328..562894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0521"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gdj:Gdia_1592
FT                   regulatory protein TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34488"
FT                   /db_xref="GOA:C6WI37"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI37"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34488.1"
FT                   /translation="MRRRGAELERAVLDAATAELLESGYRALTMERVAKRAGTNKNALY
FT                   RRWPHRAALAAAAYRALVADTTRTPDTGDLRADVLALLRGLAADLASPRGEVLTGMVAG
FT                   IAAEAPELLAELRELGAQAGSGVWLTVLGRAVARGEARPEALLPRVAGLPLVLLRNEFL
FT                   TGGPPTDEALVEIVDQVYLPLVRVR"
     atgcgccgaa ggggagccga gctggagcgc gcggtgctcg acgccgccac cgccgagctg        60
     ctggagtccg ggtaccgggc gctcaccatg gagcgcgtcg ccaagcgggc gggcaccaac       120
     aagaacgccc tctaccgccg ctggccgcac cgcgccgcgc tcgccgccgc cgcgtaccgc       180
     gcgctcgtcg ccgacaccac ccgcaccccg gacaccggcg acctgcgcgc cgacgtgctc       240
     gccctgctcc gcggcctggc cgccgacctg gcctcgcccc gcggcgaggt gctcaccggc       300
     atggtcgcgg gcatcgccgc cgaggcgccc gagctgctgg ccgaactgcg cgagctgggc       360
     gcgcaggccg gttccggggt gtggctgacc gtcctcgggc gggccgtcgc gcgcggcgag       420
     gccaggccgg aggcgctgct gcccagggtc gcgggactgc cgctcgtgct gctgcgcaac       480
     gagttcctga ccggcggtcc ccccaccgac gaggcgctcg tggagatcgt cgaccaggtc       540
     tacctgccgc tggtgcgcgt caggtag                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page