(data stored in ACNUC7421 zone)

EMBL: CP001630.PE515

CP001630.PE515       Location/Qualifiers
FT   CDS_pept        563263..564681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0522"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bpt:Bpet1644 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34489"
FT                   /db_xref="GOA:C6WI38"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI38"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACU34489.1"
FT                   /translation="MGESAGKTERPAQPEQPAQPAQPELNRAIGPKLLLFFVVGDILGT
FT                   GVYALTGNVAGKIGGALWLPFLIAFAVAFLTAFSYLELVGKYPKAAGAALYAHRAFGVQ
FT                   FLTFMVAFAVMSSGITSAASAALAFGRTYLQSVLREFSSDSVTVSASLVAVLFILGLAV
FT                   VNLRGVSESVKANVVLTCIEVSGLLIIIVIGALAVASGDGDPSRLVQIDPAPGQSALIA
FT                   ITSATSLAFFAMVGFEDSVNMAEECRDPVRIFPRAVLWGMGIAALIYVLVAVTSSLLIP
FT                   ADELAASGSNALLKVVQVGAPSFPLWVFSLIGLFAVINSALINMLMASRLVYGMAGERI
FT                   IPRFFGVVHPTRRTPWVSVLFTTGVAIALVLTTDIAKLGGTTALLLLVVFAIVNVAVLV
FT                   LRKDRADHEHFRAPTIVPVLGALTCAYLASPLSGRPSADYLVALYLLLAGLVLWLINRV
FT                   THGVVEVDPAKLGK"
     atgggggaat cggcaggcaa gaccgaacga cccgcgcagc ccgaacagcc cgcgcagccc        60
     gcgcagcccg agctgaaccg ggccatcggc cccaagctgc tgctgttctt cgtggtcggc       120
     gacatcctcg gcaccggcgt ctacgcgctg accggcaacg tggcgggcaa gatcggcggc       180
     gccctctggc tgccgttcct gatcgccttc gccgtcgcgt tcctcaccgc gttcagctac       240
     ctcgaactcg tcggcaagta cccgaaggcc gcaggcgccg cgctctacgc ccaccgcgcg       300
     ttcggcgtcc agttcctcac cttcatggtc gccttcgccg tgatgagctc cggcatcacc       360
     tcggccgcct cggccgcgct cgcgttcggc cggacctacc tccagtccgt gctccgcgag       420
     ttctcctccg actcggtcac ggtctccgcg tccctggtcg cggtgctgtt catcctcggc       480
     ctcgcggtgg tgaacctgcg cggcgtctcc gagtcggtca aggccaacgt cgtgctcacc       540
     tgcatcgagg tctccggcct gctgatcatc atcgtgatcg gcgcgctcgc ggtggcctcc       600
     ggcgacggcg acccgtcccg cctggtgcag atcgacccgg cccccggcca gtccgcgctg       660
     atcgcgatca cctcggcgac ctcgctcgcg ttcttcgcca tggtcggctt cgaggactcg       720
     gtcaacatgg ccgaggagtg ccgcgacccg gtccgcatct tcccgcgcgc ggtcctgtgg       780
     ggcatgggca tcgccgcgct gatctacgtc ctggtcgcgg tcacctcgtc gctgctgatc       840
     cccgccgacg agctcgccgc ctccggcagc aacgccctgc tcaaggtggt ccaggtcggc       900
     gcgccctcgt tcccgctgtg ggtgttctcc ctgatcggcc tgttcgccgt catcaactcc       960
     gcgctgatca acatgctgat ggccagccgc ctcgtctacg gcatggcggg cgagcggatc      1020
     atcccgaggt tcttcggcgt cgtgcacccc acccgccgca ccccgtgggt ctccgtcctg      1080
     ttcaccaccg gcgtcgcgat cgccctcgtc ctgaccaccg acatcgccaa gctcggcggc      1140
     accaccgcgc tgctgctcct ggtcgtcttc gccatcgtca acgtcgccgt cctggtgctg      1200
     cgcaaggacc gcgccgacca cgagcacttc cgcgccccca cgatcgtccc cgtgctgggc      1260
     gcgctcacct gcgcctacct ggccagcccg ctgtccggcc gcccgtccgc cgactacctg      1320
     gtcgcgctct acctgctgct cgcgggcctg gtgctgtggc tgatcaaccg ggtcacccac      1380
     ggcgtcgtcg aggtcgaccc ggccaagctc ggcaagtga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page