(data stored in ACNUC7421 zone)

EMBL: CP001630.PE516

CP001630.PE516       Location/Qualifiers
FT   CDS_pept        564778..565650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0523"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: sfv:SFV_3620
FT                   putative aldose-1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34490"
FT                   /db_xref="GOA:C6WI39"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037480"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI39"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ACU34490.1"
FT                   /translation="MLEIAHGGARAVIAKVGAGLKSFEVDGVPYVETYDGEPPMGSGAV
FT                   LVPWPNRTAGGTWVLDGAEQQLEIGETARGNAIHGLVRHAEWTVVEHTGSLVSLEVGVE
FT                   GQGWPVPLRTTITYALDDEGLTVSHGVHNLGSARTPFGVGTHPYPRAGKSSTDTSTLTL
FT                   AATTVLPLDPERMIPSGPAVPVSGESDFRAARLLKGVELDTPFGGCEPVDGLVRHQLRG
FT                   PDGGVEVWADPDFKWVQVYTPDNFPGRGRAVAIEPMTCPPDALNSGVDLLWLAPGESWA
FT                   GRWGLRPLA"
     atgctggaga tcgcccacgg cggcgcgcgc gccgtcatcg ccaaggttgg cgccggactg        60
     aagtccttcg aggtagacgg ggtgccgtac gtcgagacgt acgacggcga accgccgatg       120
     ggcagcggcg cggtgctcgt gccgtggccc aaccgcaccg cgggcggcac ctgggtgctc       180
     gacggtgccg agcagcagct cgagatcggc gagaccgcgc gcggcaacgc catccacggc       240
     ctggtgcggc acgccgagtg gaccgtcgtc gagcacaccg ggtccctggt gtcgctggag       300
     gtcggcgtcg agggccaggg ctggccggtg ccgctgcgca ccaccatcac ctacgccctg       360
     gacgacgagg gcctgaccgt ctcgcacggc gtgcacaacc tcggctccgc gcgcaccccg       420
     ttcggcgtcg gcacccaccc gtacccgagg gcgggcaagt ccagcaccga cacgtccacg       480
     ctcaccctgg ccgccaccac cgtgctgccg ctggacccgg agaggatgat cccctccggg       540
     cccgccgtcc cggtgtcggg cgagagcgac ttccgggccg cccgcctgct caagggcgtc       600
     gagctggaca ccccgttcgg cggctgcgag ccggtcgacg gcctggtgcg gcaccagctg       660
     cgcggcccgg acggcggcgt cgaggtgtgg gccgacccgg acttcaagtg ggtgcaggtc       720
     tacaccccgg acaacttccc cggccggggc agggcggtcg cgatcgagcc gatgacgtgc       780
     ccgccggacg ccctcaactc gggcgtcgac ctgctgtggc tggcccccgg cgagagctgg       840
     gcgggtcgct ggggtttgcg cccgctggcc tag                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page