(data stored in ACNUC7421 zone)

EMBL: CP001630.PE517

CP001630.PE517       Location/Qualifiers
FT   CDS_pept        565670..566863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0524"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bha:BH3008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34491"
FT                   /db_xref="GOA:C6WI40"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI40"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACU34491.1"
FT                   /translation="MSVAITGGYVVPVIGEPIENGTVLVIDGKIAAVGASVEVPDGVPT
FT                   VDAKGSWVLPGFVEAHGHIGVHEEAEGWAGQDTNEMTDPNGARLRALDAINPADMGFAD
FT                   ALSGGVTTAVIKPGSGNPIGGQTVAIKCWGRTTDEMLVREPISVKSALGENPKRVYGDQ
FT                   KKLPSTRQGVAAVIRDAFTAAQDYVARRDAAEGPFDRNPTHEVLAKVLSGELPWCQHCH
FT                   RADDIATALRLADEFGYRLVINHGTEGHLVADLIAERGVPVIVGPLFTTRSKVELRQRT
FT                   LRTPGVLARAGVKVAITTDHPVIPINFLVHQATLAVKEGMDRTAALESITTNPAAILGL
FT                   DDRVGALKPGLDGDVVIWSGDPLDVMSRATKVFVSGREVYSYEDGEGKVADPFYREG"
     atgagcgtcg ctatcacggg tgggtacgtc gtcccggtca tcggtgagcc gatcgagaac        60
     gggaccgtgc tggtcatcga cgggaagatc gccgcggtcg gcgcctcggt ggaggtgccc       120
     gacggcgtgc ccaccgtgga cgcgaagggg tcctgggtcc tgcccggctt cgtggaggcc       180
     cacggccaca tcggcgtcca cgaggaggcc gagggctggg cgggccagga caccaacgag       240
     atgaccgacc ccaacggcgc ccgcctgcgc gcactggacg ccatcaaccc ggccgacatg       300
     ggcttcgccg acgccctctc cggcggcgtc accaccgccg tcatcaagcc cggctccggc       360
     aaccccatcg gcggccagac cgtcgcgatc aagtgctggg gccgcaccac cgacgagatg       420
     ctcgtgcgcg agcccatcag cgtgaagagc gccctcggcg agaaccccaa gcgcgtctac       480
     ggcgaccaga agaagctgcc ctccacccgg cagggcgtcg ccgccgtcat ccgcgacgcg       540
     ttcaccgccg cccaggacta cgtcgccagg cgcgacgccg ccgagggccc gttcgaccgc       600
     aaccccaccc acgaggtgct cgccaaggtc ctgtccggcg agctgccctg gtgccagcac       660
     tgccaccgcg ccgacgacat cgccaccgcc ctgcgcctgg ccgacgagtt cggctaccgg       720
     ctcgtgatca accacggcac cgagggccac ctcgtcgccg acctgatcgc cgagcgcggc       780
     gtcccggtca tcgtcggccc gctgttcacc acccgctcca aggtcgagct gcgccagcgc       840
     accctgcgca cccccggcgt gctggcccgc gcgggcgtca aggtcgccat caccaccgac       900
     cacccggtga tcccgatcaa cttcctggtg caccaggcca ccctcgcggt caaggagggc       960
     atggaccgga ccgccgcgct ggagtccatc accaccaacc cggccgccat cctcggcctg      1020
     gacgaccggg tgggcgcgct caagcccggc ctggacggcg acgtggtcat ctggtccggc      1080
     gacccgctcg acgtgatgag ccgcgccacg aaggtgttcg tcagcggtcg cgaggtctac      1140
     tcctacgagg acggcgaggg caaggtcgcc gacccgttct accgcgaggg ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page