(data stored in ACNUC7421 zone)

EMBL: CP001630.PE518

CP001630.PE518       Location/Qualifiers
FT   CDS_pept        complement(566946..568091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0525"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: bat:BAS5190 acyl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34492"
FT                   /db_xref="GOA:C6WI41"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI41"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU34492.1"
FT                   /translation="MPAERLLPTTESEDLIALVREIARDELAPKAGLHEEEGRFPRDAF
FT                   RLLGGVGLLGLPYPEDFGGSAQPYEVYLQALEEVATAWMSVAVGLSVHVMSSYALVNFG
FT                   TPEQRAKWLPDALGGELLGGYALSESHAGSDAAALSTRAVREGDEYVVRGTKAWITHGG
FT                   VADFYTLMARTGEPGGRGVSCFFAPGELDGLSAAAPERKMGLTGSVTAQLTFDGARFGA
FT                   DRLIGAEGDGMRIALSALDSGRLGIAACAVGLAQAALDEAVAYARGRSQFGRPIIEFQG
FT                   LEFLLADMAAAVDSARATYLDAARRRDRGLPFTRQAAVAKLVCTDAAMKVTTDAVQVLG
FT                   GAGYTRDFPVERYMREAKVLQIFEGTNQIQRVVIGRALRKA"
     atgccagccg agcggctgct gcccaccacc gagtccgagg acctgatcgc gctggtcagg        60
     gagatcgcgc gggacgaact ggcccccaag gcggggctgc acgaggagga gggccgcttc       120
     cccagggacg cgttccgcct gctgggagga gtgggactgc tgggactccc gtaccccgag       180
     gacttcgggg ggagcgccca gccgtacgag gtgtacctcc aggcgctgga ggaggtggcc       240
     acggcctgga tgtcggtcgc cgtcggcctg tccgtgcacg tgatgtcgtc gtacgcgctg       300
     gtgaacttcg gcacgccgga gcagcgggcg aagtggctgc cggacgcgct cggcggtgag       360
     ctgctgggcg ggtacgcgct gtccgagtcg cacgccgggt cggacgcggc ggcgctgtcc       420
     acgcgggcgg tgcgcgaggg cgacgagtac gtggtgcgcg gcacgaaggc gtggatcacg       480
     cacggcgggg tggccgactt ctacaccctg atggccagga ccggcgagcc cggcggacgc       540
     ggggtgagct gcttcttcgc gcccggcgag ctggacgggc tgagcgcggc ggcccccgag       600
     cgcaagatgg gcctgaccgg gtcggtgacc gcgcagctca cgttcgacgg ggcgcggttc       660
     ggcgcggacc ggctgatcgg ggccgagggc gacgggatgc ggatcgcgct gagcgcgctc       720
     gactccgggc ggctggggat cgcggcctgc gcggtcgggc tggcgcaggc ggcgctggac       780
     gaggcggtgg cctacgcgcg cggccggagc cagttcgggc ggccgatcat cgagttccag       840
     gggctggagt tcctgctcgc ggacatggcc gcggcggtgg actcggcgcg ggcgacctac       900
     ctggacgcgg cgcggcggcg ggaccgggga ctgccgttca cccggcaggc ggcggtggcg       960
     aagctggtgt gcacggacgc ggccatgaag gtgacgacgg acgcggtgca ggtgctcggc      1020
     ggggccgggt acacgcggga cttcccggtg gagcggtaca tgcgcgaggc gaaggtgctc      1080
     cagatcttcg agggcaccaa ccagatccag cgcgtggtga tcgggcgggc gctgcgcaag      1140
     gcctga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page