(data stored in ACNUC7421 zone)

EMBL: CP001630.PE52

CP001630.PE52        Location/Qualifiers
FT   CDS_pept        56251..57537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_0951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34026"
FT                   /db_xref="GOA:C6WDN1"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34026.1"
FT                   /translation="MTSDQRAGLPPLPESMLPRDHALYRPRHSGRQRPALVAAGVYFLL
FT                   PLLLLAVGVRPGEFENRQLAEFPSVTDGWDFFTGLSDWADDHIPLREQAVAAADGISRG
FT                   VFGEPAPLRGPSTGTGPIPEVPSKDPSADRPTPTGHVRVLEGKDDWLYLGLDVEGACDP
FT                   DFLLGDTLGKLKSLRAAVESSGRRFVLVVPPNKSTAMPEKLPSKYYGADCAAKARDDLW
FT                   KRLPETGAIDLRSALADEAKRLQAPVYLQRDSHWNHAGAMVMVRRVAEEVQPGVTGSWK
FT                   VEPAEESKVAADLPTLLGHPEEITLTSYDVLADGKKKAGEPLKGPWDQPKTTTKARGTG
FT                   IANATALLIGDSFSEQAAPYLSGVFTRFTYQNAATIQADPAATARLMVQNDVVVVEMVE
FT                   RNVVIGASSLLAEGTLNEIKAQLAANPKR"
     gtgacctctg accagcgcgc agggctgccg ccgctgccgg agtcgatgct ccccagggac        60
     cacgccctct accgcccccg gcactcgggc aggcagcgcc ccgccctggt cgcggccggg       120
     gtctacttcc tcctcccgct gctcctgctg gcggtcggcg tgcggccggg cgagttcgag       180
     aaccgccagc tcgccgagtt cccctcggtc accgacggct gggacttctt caccgggttg       240
     agcgactggg ccgacgacca catcccgctg cgcgagcagg ccgtcgccgc ggccgacggg       300
     atcagccggg gcgtcttcgg cgagcccgcg cccctgcgcg gcccctccac cggcaccggg       360
     cccatccccg aggtcccctc caaggacccg tccgccgacc gccccacccc gaccggccac       420
     gtgcgcgtgc tggagggcaa ggacgactgg ctctacctcg gcctcgacgt cgagggcgcc       480
     tgcgaccccg acttcctgct cggcgacacc ctcggcaagc tcaagtccct gcgcgccgcc       540
     gtcgagtcgt ccggccgccg cttcgtgctg gtcgtgcccc cgaacaagtc cacggccatg       600
     cccgagaagc tcccgtccaa gtactacggc gccgactgcg cggccaaggc ccgcgacgac       660
     ctgtggaagc ggctgcccga gaccggcgcg atcgacctgc gctccgcgct cgccgacgag       720
     gcgaagcgcc tccaggcccc cgtctacctc cagcgcgact cgcactggaa ccacgcgggc       780
     gcgatggtca tggtccgcag ggtcgccgag gaggtccagc ccggcgtcac cggctcctgg       840
     aaggtcgagc ccgccgagga gtcgaaggtg gccgccgacc tccccacgct gctcggccac       900
     cccgaggaga tcaccctgac ctcctacgac gtcctcgccg acggcaagaa gaaggcgggc       960
     gagccgctca aggggccgtg ggaccagccc aagaccacca ccaaggccag ggggacgggc      1020
     atcgccaacg ccaccgccct gctcatcggc gactcgttca gcgagcaggc cgcgccctac      1080
     ctgtccgggg tcttcacccg gttcacctac cagaacgcgg ccaccatcca ggccgacccg      1140
     gcggccaccg cccggctcat ggtccagaac gacgtggtcg tggtcgagat ggtcgagcgc      1200
     aacgtcgtga tcggcgccag ctcgctgctc gccgagggga ccctgaacga gatcaaggcg      1260
     cagctggccg ccaacccgaa gcgctga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page