(data stored in ACNUC7421 zone)

EMBL: CP001630.PE520

CP001630.PE520       Location/Qualifiers
FT   CDS_pept        568767..569705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0527"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: sit:TM1040_3042
FT                   PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34494"
FT                   /db_xref="GOA:C6WI43"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI43"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACU34494.1"
FT                   /translation="MIVVAGEALVDLVPTSEGNLAPRLGGGPFNVAVAVGRLGVPVSFL
FT                   SRVSRDLFGDRVVERLTASGAATDLVTRGPEPTTLAVVGLADDGSARYTFYVEGTADRL
FT                   VADPGPLPSDVRAVSFGTLSMVLEPGASAYEAVLRRESARGALTALDPNIRASLIPDAD
FT                   AYRARFRSWLPDVGLLKVSVEDARWLADLPEDAPEDDVLAAARQWQSEGPAVVVLTRGG
FT                   DGLAVLTGSGEVIHVPPVAVQVVDTIGAGDTVQGALLAWLHDHDALSAEAVRGLDGASW
FT                   IRALSYAGAAAAITCSRAGAEPPFKRELEMT"
     ttgatcgtcg ttgctggtga ggccctcgtg gacctcgtgc ccacgtccga ggggaacctc        60
     gccccgcgcc tgggcggggg gccgttcaac gtggccgtcg ccgtcggcag gctgggcgtg       120
     ccggtgtcgt tcctgtccag ggtctcgcgg gacctgttcg gcgaccgggt cgtggagcgg       180
     ctgaccgcct cgggcgcggc caccgacctg gtgacgcgcg gccccgagcc gaccaccctc       240
     gcggtcgtcg gcctcgcgga cgacgggtcc gcccggtaca ccttctacgt cgagggcacc       300
     gccgaccggc tcgtggccga ccccggccct cttccgagtg atgtgcgcgc ggtgtccttc       360
     ggcaccctgt cgatggtcct ggagcccggc gcgagcgcct acgaggccgt cctgcgccgc       420
     gagtccgcgc gcggcgcgct caccgcgctg gacccgaaca tccgcgcgag cctcatcccg       480
     gacgccgacg cctaccgggc ccgcttccgc tcgtggctgc ccgacgtcgg gctgctcaag       540
     gtgtccgtcg aggacgcccg ctggctcgcc gacctccccg aggacgcgcc cgaggacgac       600
     gtgctcgccg ccgcccggca gtggcagtcc gagggcccgg ccgtggtggt gctcacccgc       660
     ggtggcgacg gactggccgt tctcaccgga tcgggcgagg tgatccacgt cccaccggtg       720
     gccgtccagg tggtcgacac gatcggcgcg ggcgacaccg tgcagggcgc gctgctggcc       780
     tggctgcacg accacgacgc gctgtccgcc gaggcggtgc gcggtctgga cggggcgtcg       840
     tggatcaggg cgctgtccta cgcgggcgcc gccgcggcca tcacctgctc gcgggccggg       900
     gccgagcccc cgttcaaacg cgagctggag atgacctag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page