(data stored in ACNUC7421 zone)

EMBL: CP001630.PE521

CP001630.PE521       Location/Qualifiers
FT   CDS_pept        569976..571289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0528"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: scl:sce8281 hypothetical protein; TIGRFAM:
FT                   citrate synthase I; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34495"
FT                   /db_xref="GOA:C6WI44"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI44"
FT                   /inference="protein motif:TFAM:TIGR01798"
FT                   /protein_id="ACU34495.1"
FT                   /translation="MSDATTAPNDPRTVALRHDGGEHEMQLVRATEGASGIDLGKLLAK
FT                   TGLVTLDSGFVNTASCSSEITYIDGDAGILRYRGYPIEQLAEKSNFLEVSYLLINGELP
FT                   TEAQLADFSSKISRHTLLHEDLKRFFDGFPRDAHPMPVLSSAVSALSTFYQDSLNPFDT
FT                   KQVEMSTIRLLAKVPTIAAYAYKKSVGQPFLYPDNSLGLVENFLRMTFGFPAEPYDVDP
FT                   DLVKALDLLFILHADHEQNCSTSTVRLVGSSEANLFASISAGINALFGPLHGGANSAVL
FT                   EMLEKIRNEGGDVASFVKKVKNKEDGVRLMGFGHRVYKNYDPRAAIIKRTADDILGKLG
FT                   GDDQLLDIAKALEEAALSDDYFVERKLYPNVDFYTGLIYRAMGFPTKFFTVLFALGRLP
FT                   GWIAHWREMINDPATKIGRPRQIYIGSPARDFVPMTER"
     atgtccgacg cgacgactgc gccgaacgac ccccgtaccg tcgcgctccg ccacgacggc        60
     ggagagcacg agatgcagct ggtccgggcg accgagggtg cctccggcat cgacctcggc       120
     aagctcctgg ccaagacggg cctcgtcacc ctggacagcg gcttcgtcaa caccgcgtcc       180
     tgctcctccg agatcaccta catcgacggc gacgcgggca tcctgcgcta ccgcggttac       240
     ccgatcgagc agctcgcgga gaagtccaac ttcctggagg tcagctacct gctgatcaac       300
     ggcgagctgc cgaccgaggc gcagctggcc gacttctcct ccaagatcag caggcacacc       360
     ctgctgcacg aggacctcaa gcggttcttc gacggcttcc cgcgcgacgc gcaccccatg       420
     ccggtgctgt cgtccgcggt gtccgcgctg tccacgttct accaggacag cctgaacccg       480
     ttcgacacca agcaggtcga gatgtcgacc atccgcctgc tggccaaggt ccccaccatc       540
     gcggcctacg cctacaagaa gtccgtcggc cagccgttcc tgtacccgga caacagcctg       600
     ggtctggtgg agaacttcct gcgcatgacg ttcggcttcc ccgccgagcc gtacgacgtc       660
     gaccccgacc tggtgaaggc gctcgacctg ctgttcatcc tgcacgcgga ccacgagcag       720
     aactgctcca cgtccaccgt gcgcctggtc ggctcgtccg aggccaacct cttcgcctcc       780
     atctccgcgg gcatcaacgc cctgttcggc ccgctgcacg gcggcgccaa cagcgccgtc       840
     ctggagatgc tggagaagat ccgcaacgag ggcggtgacg tcgcctcgtt cgtgaagaag       900
     gtcaagaaca aggaggacgg cgtccgcctg atgggcttcg gccaccgggt ctacaagaac       960
     tacgacccgc gcgccgcgat catcaagcgc acggccgacg acatcctcgg caagctcggc      1020
     ggcgacgacc agctgctgga catcgccaag gccctggagg aggccgcgct cagcgacgac      1080
     tacttcgtcg agcgcaagct gtacccgaac gtggacttct acaccggcct gatctaccgg      1140
     gcgatgggct tcccgacgaa gttcttcacg gtgctgttcg cgctcggccg cctccccggc      1200
     tggatcgccc actggcgcga gatgatcaac gacccggcca ccaagatcgg ccgcccccgg      1260
     cagatctaca tcggctcccc ggcgcgcgac ttcgtgccga tgaccgagcg ctga            1314
//

If you have problems or comments...

PBIL Back to PBIL home page