(data stored in ACNUC7421 zone)

EMBL: CP001630.PE522

CP001630.PE522       Location/Qualifiers
FT   CDS_pept        571555..572820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0529"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="PFAM: DNA photolyase FAD-binding; DNA photolyase
FT                   domain protein; KEGG: cvi:CV_3481 deoxyribodipyrimidine
FT                   photo-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34496"
FT                   /db_xref="GOA:C6WI45"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI45"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ACU34496.1"
FT                   /translation="MTSSTVVWFRRDLRVEDHPALLEAADRADRALALFVLDPKLLRPS
FT                   GKPRTDFLHRCLKSLDDRLGGRLMVVEGDPVEVVPAVAREIGAETVHVSADTGPYGRRR
FT                   DEAVGEEVELVEAGSPYAVKPGRVRKADGTPYRVFTPFYRAWADHGWRRPADTDASTVD
FT                   WIKPPRSTRPRAKALPDVAELWERFRDERLPDYHRTRDIPGVDGTSRFSAFLRWGVVHP
FT                   RTLLDDLGQDEGSKVFRSELAWREFYADVLWHHPASARHNLDRRFDRIELDEDRDHFDA
FT                   WRQGRTGYPIVDAGMRQLLEEGWMHNRVRMITASFLVKDLHLPWWWGARHFMEHLVDGD
FT                   LASNQHNWQWAAGSGTDAAPYFRVFNPITQGQKFDPKGDYIRRYVPELRDVAGKAVHQP
FT                   RDPIVDHAHERQVALDRFAAIK"
     gtgacttcct cgaccgtggt gtggttccgc cgagacctgc gcgtggagga ccaccccgcg        60
     ctgctggagg cggcggaccg cgcggaccgc gcgctggccc tgttcgtgct ggacccgaag       120
     ctgctgcgcc cgtccggcaa gcccaggacc gacttcctgc accgctgcct caagtccctg       180
     gacgaccgcc tgggcggcag gctcatggtg gtcgagggcg acccggtcga ggtggtcccg       240
     gcggtggcgc gggagatcgg cgccgagacc gtgcacgtct ccgccgacac cggcccgtac       300
     ggccgcaggc gcgacgaggc cgtgggggag gaggtcgagc tggtggaggc cgggtccccg       360
     tacgccgtca agcccggccg ggtgcgcaag gccgacggca ccccctaccg ggtgttcacc       420
     ccgttctacc gggcctgggc ggaccacggc tggcgccgcc ccgcggacac cgacgcgtcc       480
     accgtggact ggatcaagcc cccgcgcagc acccgtccca gggcgaaggc cctgccggac       540
     gtggccgagc tgtgggagcg cttccgcgac gagcgcctgc cggactacca ccgcacccgc       600
     gacatccccg gcgtggacgg cacgagccgg ttctccgcgt tcctgcgctg gggcgtggtg       660
     caccccagga ccctcctgga cgacctcggc caggacgagg gctccaaggt gttccgcagc       720
     gagctggcgt ggcgcgagtt ctacgccgac gtcctctggc accaccccgc cagcgcccgc       780
     cacaacctgg accgccgctt cgaccgcatc gagctggacg aggaccgcga ccacttcgac       840
     gcctggcgcc agggccgcac cggctacccg atcgtggacg ccgggatgcg ccagctgctg       900
     gaggagggct ggatgcacaa ccgggtgcgc atgatcacgg cgagcttcct ggtcaaggac       960
     ctgcacctgc cgtggtggtg gggcgcccgg cacttcatgg agcacctcgt cgacggcgac      1020
     ctggcgtcca accagcacaa ctggcagtgg gcggcgggca gcgggaccga cgcggccccc      1080
     tacttccggg tgttcaaccc gatcacccag ggccagaagt tcgacccgaa gggcgactac      1140
     atccggcgct acgtcccgga gctgcgggac gtggcgggca aggcggtcca ccagccgagg      1200
     gacccgatcg tggaccacgc ccacgagcgc caggtggccc tggaccgctt cgccgcgatc      1260
     aagtag                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page