(data stored in ACNUC7421 zone)

EMBL: CP001630.PE523

CP001630.PE523       Location/Qualifiers
FT   CDS_pept        complement(572906..573550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0530"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: tgr:Tgr7_2171 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34497"
FT                   /db_xref="GOA:C6WI46"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI46"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU34497.1"
FT                   /translation="MRVVLAEDGVLLRAGVEEVLRRFGIEVVASVGDAPALLDAVAAGS
FT                   PDLVLTDVRMPPGDGDDGLRAAVRLRADDPRLPVVVFSQYVAGEYAEELLSSGDGQGVG
FT                   YLLKDRVVDVAEFVDVLRRVAAGGTVIDHEVVRSLLGRRRDPLARLTGREREVLALVAE
FT                   GMANSAVGRRLGVTEAAVHKHVGSILLKLGLPPGVEGNRRVLAVLAYLRAS"
     gtgcgggtgg tgctggccga ggacggggtg ctgctgcggg ccggggtgga ggaggtgctg        60
     cggcggttcg ggatcgaggt ggtggcctcg gtcggggacg cccccgcgct gctcgacgcc       120
     gtggccgccg gctcacccga cctggtgctc accgacgtcc ggatgccgcc gggcgacggg       180
     gacgacgggc tgcgcgcggc ggtccggctg cgggcggacg acccccggtt gccggtggtg       240
     gtgttcagcc agtacgtggc gggcgagtac gcggaggagc tgctctcgtc cggtgacggg       300
     cagggggtcg ggtacctgct caaggaccgg gtcgtggacg tcgccgagtt cgtcgacgtg       360
     ctgaggcggg tcgccgccgg ggggacggtg atcgaccacg aggtggtccg gtcgctgctg       420
     ggcaggcggc gcgacccgct ggcccggttg accgggcggg agcgggaggt gctggcgctg       480
     gtggccgagg ggatggcgaa ctcggccgtc gggcggcggt tgggcgtcac cgaggccgcg       540
     gtgcacaagc acgtggggag catcctgctc aagctcgggc tgccgccggg ggtggagggg       600
     aaccggcggg tgctggcggt gctcgcctac ctgcgggcct cgtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page