(data stored in ACNUC7421 zone)

EMBL: CP001630.PE524

CP001630.PE524       Location/Qualifiers
FT   CDS_pept        complement(573565..574854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0531"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerization and phosphoacceptor region;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   mmr:Mmar10_2544 putative signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34498"
FT                   /db_xref="GOA:C6WI47"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI47"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU34498.1"
FT                   /translation="MDESRDVVGALRRKGFLVSVWPWRALLHALTTPLVAAVAALPLAP
FT                   VGVLWAAVVVKVVRGEVVGGVVPVAALLLGAVLAAALPVLSAPVAWAERWRLVLLGDDR
FT                   LAAVRQAPGLGAWVRSRYLTAAAWRETGYAVLLALAGTGLGGVLLLAGGVPLAMLLAPL
FT                   LVTPDSPLVVLGWRAVTPADGLWFTAAGIALAPVLAYAVGLLGAGHLVVGRVLLRGDEA
FT                   LRAELAEVAGSRARLVDRFDAERRRIERDLHDGAQERLVGLTLRLGLAKAELPENEDVA
FT                   AAHDQAKRLMVELRELVRGIHPAVLTDRGLGAALAELADRSVVPVTLRAHLPTRPPAHL
FT                   ESVAYFVVAEAVANAVKHSGAGEVRVRAGIEGGGVVVEVLDDGRGGADPAAGSGLTGLA
FT                   DRVAVVGGALSLSSPVGGPTVLRATLPLSG"
     gtggacgaat cgcgggacgt ggtgggcgcg ttgcggcgca agggtttcct ggtctcggtg        60
     tggccgtggc gggcgctgct gcacgcgctg acgacgccgc tggtcgcggc ggtggcggcg       120
     ctgccgctcg ccccggtggg ggtgctgtgg gcggcggtgg tggtcaaggt ggtgcgcggc       180
     gaggtggtgg gcggggtggt gccggtggcg gcgctgctgc tcggggcggt gctggcggcg       240
     gcgctgccgg tgctgtccgc gccggtggcg tgggcggagc ggtggcggct ggtgctgctg       300
     ggggacgacc ggttggccgc ggtgcggcag gcgccggggc tcggggcctg ggtgcggagc       360
     cggtacctga cggcggcggc ctggcgggag accgggtacg cggtgctgct ggcgctggcc       420
     gggaccgggc tgggcggggt gctgctgctg gcgggcgggg tgccgctggc gatgctgctg       480
     gccccgctgc tggtcacgcc ggactcgccg ctggtggtgc tggggtggcg ggccgtgacg       540
     cccgcggacg ggctgtggtt cacggcggcc gggatcgccc tggcgccggt gctggcgtac       600
     gcggtggggt tgctcggggc cgggcacctg gtggtcgggc gggtgctgct gcgcggtgac       660
     gaggcgctgc gggccgagct ggccgaggtg gcggggtcgc gggcgcggct ggtggaccgg       720
     ttcgacgccg agcggcgcag gatcgagcgg gacctgcacg acggggcaca ggagcggttg       780
     gtggggttga cgttgcggct ggggctggcg aaggcggagc tgccggagaa cgaggacgtg       840
     gcggcggcgc acgaccaggc gaagcggttg atggtggagc tgcgggagct ggtgcggggg       900
     attcacccgg cggtgctcac cgatcgtggg ctgggggcgg cgctggccga gctggcggac       960
     cggtcggtgg tgccggtgac gctgcgggcg cacctgccga cccggccgcc cgcgcacctg      1020
     gagtcggtgg cctacttcgt ggtggccgag gccgtggcga acgcggtcaa gcacagcggc      1080
     gcgggcgagg tgcgcgtgcg ggccgggatc gagggcgggg gcgtggtggt cgaggtgctg      1140
     gacgacgggc ggggtggggc cgatccggcc gcggggagcg ggttgaccgg gctggcggac      1200
     cgggtcgcgg tggtgggcgg ggcgctgtcg ctgtccagcc cggtgggcgg gccgacggtg      1260
     ctgcgggcga ccctgcccct gagcggctga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page