(data stored in ACNUC7421 zone)

EMBL: CP001630.PE525

CP001630.PE525       Location/Qualifiers
FT   CDS_pept        complement(575005..576246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0532"
FT                   /product="ABC-type Na+ efflux pump permease component"
FT                   /note="KEGG: scl:sce9075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34499"
FT                   /db_xref="GOA:C6WI48"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI48"
FT                   /inference="protein motif:COG:COG1668"
FT                   /protein_id="ACU34499.1"
FT                   /translation="MSAPSPGRALSPVRAVFLVARREFLSKVRTRSFVIGTVVIIAAMA
FT                   GFVALQALLFTSASTSVVGLNGQATVLAQPLEETARSLGREVEVVDVPDSAAGEELVRS
FT                   GDLDALVLGAPDALRVLVKDGLDPSLANAVDLIVKQQVLAAQLAEAGLDPARVQQNVAD
FT                   ARVRVVALDPEDPMVGQRLVIGLVIAGLLYYSLLVYGTMVAQGVVEEKSSRVVEILLST
FT                   LRPAQLLMGKVIGLGAVGLAQLLLIGAIGLGLASAAGVVAVDGPTGGALLIGVLWYLLG
FT                   FFLYATVFAAAASLVSRQEEVQSVLTPITMLIVIAFVVGFNLLVRDPASRLVAVLSVLP
FT                   PFAPILMPGRMAIGAAPAWQVVLAVALALGAAAGVVWVGGKVYANAVLRTGARVRLRDA
FT                   LRSPRGAAQGSARG"
     atgagcgcac cgtcccccgg ccgcgcgctg tccccggtgc gcgcggtgtt cctggtggcg        60
     cgccgggagt tcttgagcaa ggtgcgcacc cggtcgttcg tgatcggcac ggtggtgatc       120
     atcgcggcga tggccgggtt cgtggcgctg caggcgctgc tgttcacctc ggcgtcgacg       180
     tcggtggtcg ggctgaacgg gcaggcgacg gtgctcgcgc agccgttgga ggagaccgcg       240
     cgctcgctcg ggcgcgaggt cgaggtcgtg gacgtgccgg actcggcggc gggcgaggag       300
     ctggtgcggt caggggacct tgacgcgctg gtgctgggcg cgccggacgc gctgcgggtg       360
     ctggtcaagg acgggctgga cccgtcgctg gcgaacgcgg tcgacctgat cgtgaagcag       420
     caggtgctgg cggcgcagct ggccgaggcc gggctggacc cggcgcgggt gcagcagaac       480
     gtggcggacg cgcgggtgcg ggtcgtggcg ctggacccgg aggacccgat ggtcgggcag       540
     cggctggtga tcgggctggt gatcgccgga ctgctgtact actcgctgct ggtctacggg       600
     acgatggtcg cccagggcgt ggtggaggag aagtcgagcc gggtcgtgga gatcctgctg       660
     tcgacgttgc ggcccgcgca gctgctgatg ggcaaggtga tcgggctcgg cgcggtcggg       720
     ctggcgcagc tgctgctgat cggcgcgatc gggctcgggc tggcgtcggc cgccggggtg       780
     gtcgcggtgg acgggccgac cggcggggcg ctgctgatcg gggtgctctg gtacctgctg       840
     gggttcttcc tgtacgccac ggtgttcgcg gcggcggcgt cgctggtgtc gcggcaggag       900
     gaggtgcagt cggtgctgac gccgatcacg atgctgatcg tgatcgcgtt cgtggtgggg       960
     ttcaacctgc tggtcaggga cccggcgagc aggctcgtgg cggtgctgtc ggtgctgccg      1020
     ccgttcgcgc cgatcctgat gccggggcgg atggcgatcg gggccgcgcc cgcgtggcag      1080
     gtggtgctgg cggtggcgct ggcgctgggg gccgcggcgg gtgtggtgtg ggtcggcggg      1140
     aaggtgtacg cgaacgcggt gctgcggacc ggggcgcggg tgcggctgcg ggacgcgctg      1200
     cggtcgccgc ggggcgccgc gcaggggtcg gcgcgggggt ag                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page