(data stored in ACNUC7421 zone)

EMBL: CP001630.PE526

CP001630.PE526       Location/Qualifiers
FT   CDS_pept        complement(576243..577196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0533"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH1166 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34500"
FT                   /db_xref="GOA:C6WI49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI49"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34500.1"
FT                   /translation="MSQGLRGLPPHGSPSRGLLEVDRVSKRYGDVVALREMTFEVRAGE
FT                   LFGFVGSNGAGKTTTMRIALGVLEADSGQVRWNGAPIDLRTRRSIGYMPEERGLYPKMR
FT                   VLEQLVYLAELHGVAPGEALRSAELWVERLGLRERRRDEVQKLSLGNQQRVQLAAALVH
FT                   RPEVLVLDEPFSGLDPVAVDVMSQVLREQAAAGVPVVFSSHQLDLVERLCDRVGIVRGG
FT                   AMVACGTVDELRAGGVERLVVEAPGAPPGWADVVPGVLSARHEGARTVVELAPGADDQV
FT                   VLGAALATGPVHEFSRQRPSLTELFRSVVTSEESAA"
     gtgtcgcagg ggctgcgcgg gctgccgccg cacgggtcgc cgtcacgagg gctgctggag        60
     gtcgaccggg tctccaagcg ctacggggac gtcgtcgcgc tgcgggagat gacgttcgag       120
     gtgcgggcgg gcgagctgtt cgggttcgtc ggcagcaacg gggcgggcaa gaccaccacg       180
     atgcggatcg cgctgggcgt gctggaggcg gactccgggc aggtgcggtg gaacggcgcg       240
     ccgatcgacc tgcggacccg ccggtcgatc ggctacatgc cggaggagcg cgggctctac       300
     ccgaagatgc gggtgctgga gcagctggtg tacctggccg agctgcacgg ggtcgcgccg       360
     ggcgaggcgc tgcggtcggc cgagctgtgg gtggagcggc tggggctgcg ggagcggcgg       420
     cgcgacgagg tgcagaagct gagcctgggc aaccagcagc gggtgcagct ggcggcggcg       480
     ctggtgcacc ggcccgaggt gctggtgctg gacgagccgt tctccgggct ggacccggtg       540
     gcggtggacg tgatgagcca ggtgctgcgc gagcaggccg ccgccggggt gccggtggtg       600
     ttctccagcc accagctgga cctggtggag cggctgtgcg accgggtggg gatcgtgcgc       660
     ggcggggcga tggtggcctg cgggaccgtg gacgagctgc gcgcgggcgg ggtggagcgg       720
     ctggtcgtgg aggcgcccgg cgcgccgccc ggctgggcgg acgtggtgcc cggcgtgctg       780
     tccgcgcggc acgagggcgc gcgcaccgtg gtcgagctgg cgccgggcgc cgacgaccag       840
     gtggtgctgg gcgcggcgct ggcgaccggg ccggtgcacg agttctcccg gcagcggccg       900
     tcgctgaccg agttgttccg cagcgtcgtc accagcgagg agagcgccgc atga             954
//

If you have problems or comments...

PBIL Back to PBIL home page