(data stored in ACNUC7421 zone)

EMBL: CP001630.PE527

CP001630.PE527       Location/Qualifiers
FT   CDS_pept        complement(577222..577482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0534"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: gdi:GDI1973 putative
FT                   HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34501"
FT                   /db_xref="GOA:C6WI50"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI50"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34501.1"
FT                   /translation="MSPVRRGSEQPIHNRIGVLRAERGLSRADLAEAVEVNPQTIGALE
FT                   RGDHYPSLDLALRICEVFGLPVEAVFGRAPFEPLSTQVYRR"
     atgagtccgg tgcgccgggg ctccgagcag cccatccaca accggatcgg cgtgctgcgc        60
     gcggaacgcg ggctgagccg ggccgacctc gccgaggcgg tggaggtgaa cccgcagacg       120
     atcggcgcgc tggagcgcgg cgaccactac ccgagcctgg acctcgcgct gcgcatctgc       180
     gaggtgttcg ggctgcccgt cgaggcggtg ttcggccgcg ctccgttcga accgctgtcc       240
     acccaggtct accgccggtg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page