(data stored in ACNUC7421 zone)

EMBL: CP001630.PE528

CP001630.PE528       Location/Qualifiers
FT   CDS_pept        577666..578109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   lpn:lpg2755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34502"
FT                   /db_xref="GOA:C6WI51"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI51"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACU34502.1"
FT                   /translation="MEPDQWLAQYGQKIEQAKREAAQTEAKLGGVGGSATSPDGLITVT
FT                   VNASGALTDLILRPALRGEDPERIAAAVLKAVAEAQRAAAGQVVEIVSELVGDSPALEF
FT                   VKSRMPNGYSGDGTDPVEPAPEVQRRDTRPDDDYFTNPPDVMA"
     atggagccgg accagtggct cgcgcagtac gggcagaaga tcgagcaggc caagcgcgag        60
     gcggcgcaga ccgaggcgaa gctcggcggg gtgggcggca gcgccacctc cccggacggg       120
     ctgatcacgg tcacggtgaa cgcctccggt gcgctgaccg acctgatcct gcgcccggcg       180
     ctgcgcggtg aggacccgga gcggatcgcg gcggccgtgc tcaaggccgt cgccgaggcg       240
     cagcgcgccg cggccgggca ggtcgtcgag atcgtgtccg agctggtcgg cgacagcccg       300
     gccctggagt tcgtgaagtc ccggatgccg aacggctatt cgggtgacgg cacggacccg       360
     gtggaaccgg ctcccgaggt gcagcgtcgg gacaccaggc ccgacgacga ctacttcacc       420
     aacccgccag acgtgatggc ctag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page