(data stored in ACNUC7421 zone)

EMBL: CP001630.PE529

CP001630.PE529       Location/Qualifiers
FT   CDS_pept        578130..578438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34503"
FT                   /db_xref="GOA:C6WI52"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34503.1"
FT                   /translation="MFDSFNVSPEQIRGHAGTVDQLTQRMVTATQTADPSLATDAFGIF
FT                   GSFLAEFLLKQAGVSQDILGQAAETVADMCQGLKEVADLYENVDLDNAFGFTGKARG"
     atgttcgact ccttcaacgt gagcccggag cagatccggg ggcacgcggg aacggtcgac        60
     cagctgacgc agcgcatggt cacggcgacc cagaccgccg acccctccct ggcgaccgac       120
     gccttcggga tcttcgggtc gttcctggcc gagttcctgc tcaagcaggc gggcgtctcc       180
     caggacatcc tcggccaggc cgccgagacc gtggccgaca tgtgccaggg gctcaaggag       240
     gtcgccgacc tgtacgagaa cgtcgacctc gacaacgcgt tcggcttcac cggaaaggcg       300
     cgcggatga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page