(data stored in ACNUC7421 zone)

EMBL: CP001630.PE53

CP001630.PE53        Location/Qualifiers
FT   CDS_pept        57672..59063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: FAP262; flagellar associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34027"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34027.1"
FT                   /translation="MLADPQPAGGTAALWSSSDLPGLGDQLLVRVIERELRARLGDWCV
FT                   RPFAPHGWTRPQRADAGFIAEPLGERTPHRVRELAENHHLHLVAPSFPLGDDLAARYGA
FT                   DVPGAAFFTAGLGLRPDAACVAVRVAEAVPAELVAWAGRQPLLSVRDEESARRLREAGV
FT                   KGEVAVVGHPGLLLERLLPADSLKARANQLRQLGQLPADGRSYLVVQVPAEGFEKLRPT
FT                   IAKIVELLAVQDVVLLPIGVPVPEGDWAALPPDTVLEDRAAVLADSAAVIAVDEHVAAA
FT                   AQAYGRNWVLLDPTGREGAAAELFGAAERVAQRPSQLAAAFRRALKAGPGGHEEAVRAL
FT                   DEHLDAVAKTAEAAFAASGQGLPDRVAALVAENRALRVAHHRLRERVTADRHAMVELTL
FT                   KGGPVEGGPELEEERRLHGELAERHRELVERLGASERELDAMRRTKLFRYTRALRFVYG
FT                   KLRSR"
     gtgctcgccg acccccagcc cgcaggcgga accgcagccc tgtggagcag cagcgacctg        60
     cccggactgg gcgaccaact cctcgtgcgc gtgatcgagc gcgagctccg cgcccgcctc       120
     ggcgactggt gcgtgcgccc gttcgccccg cacgggtgga cccggcccca gcgcgccgac       180
     gcgggcttca tcgccgagcc gctcggcgag cgcacgcccc accgggtgcg ggaactggcc       240
     gagaaccacc acctgcacct ggtcgccccc tcgttcccgc tcggggacga cctcgccgcg       300
     cgctacggcg ccgacgtgcc gggcgcggcg ttcttcaccg cgggcctcgg gctgcgcccg       360
     gacgcggcgt gcgtcgcggt ccgcgtcgcc gaggccgtgc ccgccgagct ggtcgcctgg       420
     gccggtcggc agcccctgct gtcggtgcgc gacgaggagt ccgcgcggcg gctgcgcgag       480
     gcgggcgtca agggcgaggt ggccgtggtc gggcaccccg gcctgctgct ggagcggctg       540
     ctccccgccg actcgctcaa ggcccgcgcg aaccagctgc gccagctcgg ccagctgccc       600
     gccgacgggc gcagctacct ggtcgtgcag gtgcccgccg agggcttcga gaagctccgc       660
     cccaccatcg ccaagatcgt cgagctgctg gccgtgcagg acgtggtgct gctgccgatc       720
     ggggtgcccg ttcccgaggg cgactgggcc gcgctgccac cggacacggt gctggaggac       780
     cgggccgccg tgctcgccga ctcggccgcc gtgatcgcgg tggacgagca cgtggccgcc       840
     gccgcccagg cctacgggcg caactgggtg ctgctggacc cgaccggtcg cgagggcgcc       900
     gccgccgagc tgttcggcgc ggccgagcgg gtcgcgcagc ggcccagcca gctcgccgcc       960
     gcgttccgcc gggcgctgaa ggcgggccct ggtgggcacg aggaggccgt gcgggcgctg      1020
     gacgagcacc tggacgcggt ggccaagacc gccgaggcgg cgttcgcggc cagcggccag      1080
     ggcctgcccg accgggtcgc cgcgctggtc gccgagaacc gcgcgctgcg ggtggcccac      1140
     caccggctgc gcgagcgcgt caccgccgac cggcacgcca tggtcgagct gaccctcaag      1200
     ggcggcccgg tggagggcgg ccccgagctg gaggaggagc ggcggttgca cggcgagctg      1260
     gccgagcggc accgggagct ggtggagcgg ctgggcgcct ccgagcggga gctggacgcc      1320
     atgcggcgca ccaagctctt ccgctacacg cgcgccctgc ggttcgtgta cgggaagctg      1380
     cgcagccgat ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page