(data stored in ACNUC7421 zone)

EMBL: CP001630.PE530

CP001630.PE530       Location/Qualifiers
FT   CDS_pept        578435..580219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted gene, 100041170"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34504"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34504.1"
FT                   /translation="MTPQAGTDVSTAQQRDPANLVGDVKGTADAIERGDWVAAGLGMAN
FT                   AAMSVVGLAGNPMGGLVSAGFSWAVQHVSFLKEPFDALLGNPQAITKMSDSWANAAKQV
FT                   ESIVADYRRTSVEETKGWRGRSADGYRAAATKHSSGLETLAKAAKGISTAAKGAGELVG
FT                   TVRKTIMDLIGKAVSEMVMKIIQWLSVSWLTFGASIAAAIGDIVRMACDYAKKFVDFLQ
FT                   KLATSLKKLIDMIKSVAQIAQTAKQVLQAITAMTHSNSAGAAGAGAAGNPRLSAGGLGL
FT                   TGEQLANMDRGANTRYSENGSGSTWTSGANGAGGGAAVNQPGALGPGAGAGAGSGYDGG
FT                   YGGAGGRPVVSQPPVVGGGFGGVGGGAGGSYGGSTGGSSVSRPPTVGGGVGGSGGSGGY
FT                   GGSGGGAGGSAGGHWEPGRWVPAGSGVTGVTPLPARDVTHATNTTPTIPPLTTPPIPTV
FT                   KPFGGDLGGGGGAGGGAGGGGGPMPSFGGGGGGFGGGGSAGGLGGAGGATPQPMQAGGA
FT                   SGVLPSGAAGGPAPGAPGGAPAGGARGAGGGMGMMGGAPMAPMGGQEGGKDHQRKVRIQ
FT                   GDPLAEEPPKAAKPVIGE"
     atgacccccc aggcaggcac cgacgtctcg accgcccagc agcgcgaccc ggccaacctg        60
     gtcggcgacg tcaagggcac cgccgacgcg atcgagcgcg gcgactgggt cgcggccggg       120
     ctcggcatgg ccaacgccgc catgagcgtg gtcgggctgg ccggcaaccc catgggcggg       180
     ttggtctcgg ccgggttcag ctgggccgtg cagcacgtgt cgttcctgaa ggagccgttc       240
     gacgcgctgc tgggcaaccc gcaggcgatc accaagatgt ccgacagctg ggccaacgcg       300
     gccaagcagg tcgagtcgat cgtcgccgac taccggcgca cctcggtgga ggagacgaag       360
     ggctggcggg gccggtcggc ggacggctac cgggccgccg cgaccaagca ctcgtccggc       420
     ctggagacgc tggcgaaggc ggccaagggc atctccacgg cggccaaggg cgcgggcgag       480
     ctggtcggca ccgtccgcaa gacgatcatg gacctgatcg gcaaggccgt ctccgagatg       540
     gtcatgaaga tcatccagtg gctgtcggtg tcctggctga ccttcggcgc ctccatcgcc       600
     gcggccatcg gcgacatcgt gcggatggcg tgcgactacg cgaagaagtt cgtggacttc       660
     ctgcagaagc tcgcgacctc gctgaagaag ctcatcgaca tgatcaagtc cgtcgcgcag       720
     atcgcgcaga ccgccaagca ggtcctgcag gcgatcaccg cgatgacgca ctccaactcg       780
     gcgggcgcgg cgggcgcggg cgcggccggg aaccccaggc tcagcgcggg cggcctcggg       840
     ctgaccggcg agcagctggc gaacatggac cggggggcga acacccggta cagcgagaac       900
     ggcagcggga gcacctggac cagcggcgcc aacggcgcgg gcggcggagc cgcggtgaac       960
     cagccgggtg cgctcgggcc tggtgcgggc gcgggggctg gttccggcta cgacggcggt      1020
     tacggcggcg cgggcggcag gccggtcgtg tcccagccgc ccgtggtcgg tggcggtttc      1080
     ggtggggtcg gcggcggtgc cggcggttcc tacgggggct ccacgggcgg ttcgtcggtg      1140
     tccaggccgc ccacggtcgg tggcggtgtc ggcggttccg gtgggtcggg cggctacggc      1200
     ggctccggcg gcggtgccgg cggttcggca ggcggccact gggagcccgg ccgctgggtg      1260
     cccgcgggca gcggtgtcac cggcgtgacc ccactgcccg cgcgcgacgt cacgcacgcg      1320
     accaacacga cccccacgat ccccccgctg accacgcccc ccatccccac cgtgaagccg      1380
     ttcggcggtg acctcggtgg cggtggcggt gccggcggtg gtgccggtgg cggcggcggc      1440
     ccgatgccca gcttcggcgg tggtggcggc ggcttcggcg gtggtggttc cgcaggcggc      1500
     ctgggcggcg caggcggcgc caccccccaa cccatgcagg caggcggagc ctccggcgtc      1560
     ctcccgtccg gagcggcagg cggccccgcg ccaggcgccc ccggcggcgc cccggcgggc      1620
     ggcgcacgag gcgcaggcgg cggcatgggc atgatgggcg gagccccgat ggccccgatg      1680
     gggggccagg agggcggcaa ggaccaccag cgcaaggtcc gaatccaggg cgaccccctg      1740
     gccgaggagc cgccgaaggc ggcaaagccg gtaatcggcg aataa                      1785
//

If you have problems or comments...

PBIL Back to PBIL home page