(data stored in ACNUC7421 zone)

EMBL: CP001630.PE531

CP001630.PE531       Location/Qualifiers
FT   CDS_pept        580973..582172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0538"
FT                   /product="N-isopropylammelide isopropylaminohydrolase"
FT                   /EC_number="3.5.99.4"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: bac:BamMC406_5450
FT                   N-isopropylammelide isopropylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34505"
FT                   /db_xref="GOA:C6WI54"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI54"
FT                   /inference="protein motif:PRIAM:3.5.99.4"
FT                   /protein_id="ACU34505.1"
FT                   /translation="MPGDLLIRSVRPWPADPGAPTVDVLCSNGTLTAFGPHLPAPPGAT
FT                   VVDGRNGVLLPAFTDAHAHLDSTRLGLPFRPHSAGPGLTALVDNDRRHWRADEPVADRA
FT                   TRTLGRTIASGATHVRSHAQVDVDSGLERLEGVLAAREAHRDRALVQVVAFPQCGILRE
FT                   KGTADLLDAALRAGADLIGGLDPASVDRDPVKHLDTVFSLAEKHQCGVDLHLHDDGTLG
FT                   AFQIELVCERVAALGMRGEVTISHAFALSTVDDHRQGLLVDLLAEHDVAVTTVAPGARD
FT                   PLPLHRLRRAGVRLGLGQDGIRDHWSPYGDGDMLGRAWQLAYRGGFRRDDQVEMCVDIA
FT                   TRGGAAVLGARLGLTEGSPASVVVVPGDTVTAAVMDRAPRALVVHAGRVVARDGELVRT
FT                   "
     gtgcccggag acctgctgat ccgctcagtc cgcccgtggc ccgccgaccc cggtgcgccg        60
     accgtcgacg tcctctgctc gaacggcacc ctcaccgcct tcggcccgca cctccccgcc       120
     ccacccggcg ccaccgtcgt cgacgggcgg aacggcgtgc tcctccccgc cttcaccgac       180
     gcccacgcgc acctcgactc cacccgcctc ggcctcccct tccgcccgca ctccgcaggt       240
     cccggcctca ccgccctggt cgacaacgac cgccgccact ggcgcgccga cgagcccgtc       300
     gccgaccgcg ccacccgcac cctcggccgc accatcgcct ccggcgccac ccacgtgcgc       360
     agccacgccc aggtcgacgt cgactccggc ctcgaacgcc tcgaaggcgt cctcgccgcc       420
     cgcgaggccc accgcgaccg ggcgctcgtg caggtcgtcg cgttccccca gtgcggcatc       480
     ctgcgggaga agggcaccgc cgacctgctc gacgccgcgc tgcgggcggg cgccgacctg       540
     atcggcgggc tcgaccccgc ctccgtcgac cgcgaccccg tcaagcacct cgacaccgtc       600
     ttcagcctcg ccgagaagca ccagtgcggc gtcgacctgc acctgcacga cgacggcacc       660
     ctcggcgcgt tccagatcga gctggtctgc gagcgcgtcg ccgccctcgg gatgcgcggc       720
     gaggtcacca tcagccacgc gttcgccctg tccaccgtcg acgaccaccg ccaaggcctg       780
     ctcgtcgacc tcctcgccga gcacgacgtc gccgtcacca ccgtcgcccc cggcgcccgc       840
     gaccccctgc cgctgcaccg cctgcgccgc gcgggcgtgc gcctgggcct gggccaggac       900
     ggcatccgcg accactggtc cccctacggc gacggcgaca tgctcggccg cgcctggcag       960
     ctcgcctacc ggggcgggtt ccgccgggac gaccaggtcg agatgtgcgt cgacatcgcc      1020
     accaggggcg gcgcggccgt gctcggggcc cgcctcggcc tcaccgaggg ctcgcccgcg      1080
     tccgtcgtgg tcgtgcccgg cgacacggtc accgccgccg tcatggaccg cgccccgcgc      1140
     gcgctcgtcg tgcacgcggg gcgcgtcgtc gccagggacg gcgagctggt cagaacctga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page