(data stored in ACNUC7421 zone)

EMBL: CP001630.PE532

CP001630.PE532       Location/Qualifiers
FT   CDS_pept        complement(582162..583166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0539"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; KEGG: pzu:PHZ_c1983 alcohol dehydrogenase, zinc-
FT                   containing"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34506"
FT                   /db_xref="GOA:C6WI55"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI55"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACU34506.1"
FT                   /translation="MTTAHEIHLAARPKGFPTESDFALVEVPVPAPGDGELLVRNLLMS
FT                   VDPYMRGRMRDAKSYVPPYALDAPLDGGAVGEVVESRSPDFAPGDVVLHGLGWREFAAV
FT                   PASGARKVDPDAAPLGAHLGVLGMPGLTAWVGLLEVAGMREGDAVFVSGAAGAVGQVAG
FT                   QVARLRGAKRVVGSAGSPEKVRYLVDELGFDAAFDYRDGDVAGQLAAAAPDGVDVFFDN
FT                   VGGEHLEAAITAFTTGARAALCGAISAYNAEEAPAGPRNLGLLVGKRATLRGFIVSDHA
FT                   HLREEFTREVGGWIAEGKLRYRETVTEGGLANAPAAFIGMLRGENTGKALVRF"
     atgaccaccg cgcacgagat ccacctggcc gcccgtccga agggcttccc gaccgagtcg        60
     gacttcgcgc tcgtcgaggt cccggtcccg gcgccgggcg acggggagct gctggtgcgc       120
     aacctcctga tgagcgtcga cccgtacatg cgcgggcgga tgcgggacgc gaagtcgtac       180
     gtgccgccgt acgccctgga cgcgccgctg gacggcgggg cggtcggcga ggtggtcgag       240
     tcgcggtcgc cggacttcgc gccgggggac gtcgtgctgc acgggctggg gtggcgcgag       300
     ttcgcggcgg tgcccgcctc gggggcgcgg aaggtcgacc cggacgcggc gccgctgggc       360
     gcgcacctcg gcgtgctggg gatgccgggg ctgaccgcgt gggtggggct gctggaggtc       420
     gccgggatgc gcgagggcga cgcggtgttc gtgtcgggag ccgcgggcgc ggtcgggcag       480
     gtcgcggggc aggtcgcccg gttgcgcggg gcgaagcggg tggtgggcag cgccgggtcg       540
     ccggagaagg tgcggtacct ggtggacgag ctgggcttcg acgccgcgtt cgactaccgg       600
     gacggggacg tggccgggca gctcgcggcg gcggccccgg acggggtcga cgtgttcttc       660
     gacaacgtcg gcggcgagca cctggaggcc gcgatcacgg cgttcaccac gggcgcgcgg       720
     gcggcgctgt gcggggcgat ctcggcgtac aacgccgagg aggcgcccgc cgggccgagg       780
     aacctggggc tgctggtggg caagcgcgcc accctgcgcg ggttcatcgt cagcgaccac       840
     gcgcacctgc gcgaggagtt cacccgcgag gtgggcgggt ggatcgcgga ggggaagctg       900
     cgctaccgcg agacggtcac cgagggcggg ctggcgaacg cgcccgcggc gttcatcggg       960
     atgctgcgcg gggagaacac cgggaaggcg ctggtcaggt tctga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page