(data stored in ACNUC7421 zone)

EMBL: CP001630.PE533

CP001630.PE533       Location/Qualifiers
FT   CDS_pept        complement(583222..583977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0540"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_A4874 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34507"
FT                   /db_xref="GOA:C6WI56"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR013653"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI56"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU34507.1"
FT                   /translation="MRLHHPSELSARGALIRWSAQVLVPGRDGRAFSRGDAVAVLAPAL
FT                   NRHDRLVLDGSPDDVRALLDEHYAPGLSPLVTSELAAGLGVPVRAAFGWMERADPGDLP
FT                   ERAPECAWLPESDWPEVTALLGAASPHSYVWPGEPGATRWAGIRVGGVLAAVAADAWST
FT                   DGVGFIGGVATHPGFRRQGLSSVLCAFVTAELLERHGGCALMVDRNNPTAIGVYTRLGY
FT                   AYRELSVLDPDVARSGEPKAGGVAGKSAA"
     atgcgtctgc accacccctc cgagctgtcc gcgcgcggcg cgctgatccg ctggtccgcc        60
     caggtcctcg tccccggtcg ggacgggcgc gcgttctccc gcggcgacgc ggtcgcggtc       120
     ctcgcccccg cgctcaaccg gcacgaccgg ctcgtcctgg acggctcccc cgacgacgtc       180
     cgcgccctcc tcgacgagca ctacgccccc ggcctgtcgc cgctggtcac cagcgagctg       240
     gcggccgggc tgggggtgcc ggtgcgggcc gcgttcggct ggatggagcg cgccgacccc       300
     ggcgacctgc cggagcgggc cccggagtgc gcctggctgc ccgagtcgga ctggcccgag       360
     gtgaccgccc tgctgggcgc ggcgagcccg cacagttacg tgtggccagg tgagccgggt       420
     gcgaccaggt gggccgggat cagggtcggc ggggtgctcg ccgcggtggc ggccgacgcg       480
     tggtccaccg acggggtggg gttcatcggt ggggtcgcca cgcatccggg gttccgccgc       540
     caggggctgt cgtcggtgct gtgcgcgttc gtcaccgccg agctgctgga gcggcacggc       600
     gggtgcgcgc tcatggtcga ccggaacaac cccaccgcga tcggcgtgta cacccggctc       660
     gggtacgcct accgggagct gtccgtgctc gacccggacg tggcgcggtc cggtgagccg       720
     aaggcgggcg gggtggcggg gaagagcgcg gcgtga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page