(data stored in ACNUC7421 zone)

EMBL: CP001630.PE534

CP001630.PE534       Location/Qualifiers
FT   CDS_pept        complement(584070..584606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34508"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34508.1"
FT                   /translation="MIGGPVAMTAFSASGRVPGQGPGPGSDVGPGMGSGTAQGRGAGSA
FT                   PVPGVNSGFGGALSAAERYKEVVELAGDAVERMRQVDRERVAQLIEALAESQIRMAAAI
FT                   DREKVAELGVDELWQQAVEALWEERSIESIGQRPRPDQTVPPRDQLEYDNEVELAYRGL
FT                   VESLAKRSLFRGGKS"
     atgatcggcg gtccggtggc gatgacggcg ttctcggcgt cgggacgggt tccggggcag        60
     ggacccggac cgggctcgga cgtgggccca gggatgggct cagggacggc gcagggccgc       120
     ggtgcggggt ccgcgccggt gcccggcgtc aactcggggt tcggcggcgc gctgtcggcg       180
     gccgagcggt acaaggaggt cgtcgagctc gccggtgacg cggtggagcg gatgcggcag       240
     gtcgaccggg agcgggtcgc tcagctgatc gaggcgctgg ccgagtcgca gatccggatg       300
     gccgccgcca tcgaccggga gaaggtcgcg gagctcggcg tggacgagct gtggcagcag       360
     gccgtggagg cgctgtggga ggagcggtcg atcgagagca tcggccagcg gccccggccc       420
     gaccagaccg tgccgcccag ggaccagctg gagtacgaca acgaggtgga gctggcctac       480
     cgggggttgg tggagtcgct ggccaagcgg tcgctgttcc ggggcggcaa gtcctag          537
//

If you have problems or comments...

PBIL Back to PBIL home page