(data stored in ACNUC7421 zone)

EMBL: CP001630.PE535

CP001630.PE535       Location/Qualifiers
FT   CDS_pept        complement(584603..587401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0542"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: bpt:Bpet4245
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34509"
FT                   /db_xref="GOA:C6WI58"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI58"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ACU34509.1"
FT                   /translation="MSRRDDRLWRIRASLERFHGAVAAALGNAAREQRGIAAERARDMV
FT                   EVMVRGQGVDRALADPVLAGPLRNPLFGPVLAHAMADRVEAFRDWSEQGPDRLAEIVGE
FT                   ASPGAASQPHEAWLGGTGTADGSEGVPELWRIGDGEVPSAPEPRRFPVAVPLLDQAHLH
FT                   VASAPESRATAESLVEGLLLRVLSHFQPGLVQVHVWDVGQLTGSLPGLYPLTRAGLLTV
FT                   HDPARLHELLDELSDTIRRVHTGVLVEGHQSIRAVSGRRAEPWRIAVLLGNRQALKEEH
FT                   QQQLQRVARNGLACGIQLFIVDIPITVNSPVETVRVAADHTATCTMTGKHVRVLLDPPL
FT                   PRHAVPRACAAIAEKREERRSRFGTFADLLPEEPWQERSAAGVVAPVGFFDGDPVPVAL
FT                   GDTSPHALIGGPSGSGKTNLLYAMLGSLAARYSPDELELYLLDFKEGVSFAQFAPGRKD
FT                   PSWLPHARLVGVNVNTDREFGVALLRFLADEMRRRADAAKRHEVTKLEQLREEDPEGRW
FT                   PRVVAVIDEFQYLFGERDQVTAQATQLLEDVARRGRSQGIHLVLSSQDVAGIEGFWGKS
FT                   AIFEQFTVRIALPKARRVLAEPQNDAAVELPRWHAVVNHESGVRPGNRVARVPDATKRG
FT                   TFDALQAELHRMRPEELPEPILFDGSRVPVLGGLADFQALRPGEASPTVLLGQVIDVAG
FT                   SAAKVRFARTPGRNTAVIGSMAEDAAGVLAGAALSLARQHFEGGARFTVACLVDDARPH
FT                   ADRLVKRLRGQGFEVAEVPLKDFREVPEDERRGFREVVDEHAKRLREINAGTFEGDVVP
FT                   EYLVVYGVDAAQSLLEVKDEKTRATGVDSFRLLLKHGPENRTHLLGWWRGAQRLKNSLP
FT                   PGVYDDIGSWIAFDVQGKELLSFGPEQVMSWSPRPRRGLFFDRFEHSRPQVVIPFDTGE
FT                   ES"
     gtgagcaggc gcgacgaccg cctgtggcgg atcagggcgt ccctggagcg cttccacggg        60
     gcggtggcgg cggcgctggg caacgccgcg cgcgagcagc gcggcatcgc ggccgagcgc       120
     gcccgcgaca tggtcgaggt gatggtgcgc ggccagggcg tcgaccgcgc cctggccgac       180
     ccggtgctgg cggggccgct gcggaacccg ctgttcgggc cggtgctggc gcacgcgatg       240
     gccgaccggg tcgaggcgtt ccgcgactgg tccgagcagg gccccgaccg gctggccgag       300
     atcgtcggcg aggcgtcgcc gggggccgcg tcccagccgc acgaggcgtg gctgggcggg       360
     acgggcacgg cggacggcag cgagggcgtc ccggagctgt ggcggatcgg cgacggcgag       420
     gtgccctcgg ccccggagcc ccggcggttc ccggtggcgg tgccgctgct ggaccaggcg       480
     cacctgcacg tggcgtccgc gcccgagtcg cgcgcgacgg cggagtcgct ggtggagggc       540
     ctgctgctgc gggtgctcag ccacttccag ccgggcctgg tgcaggtgca cgtgtgggac       600
     gtcggccagc tgaccggctc gctgcccggc ctgtacccgc tgaccagggc gggcctgctg       660
     accgtgcacg acccggcgcg gctgcacgag ctgctggacg agctgtccga caccatccgc       720
     cgggtgcaca ccggtgtgct ggtggagggc caccagtcga tcagggcggt cagcggcagg       780
     cgcgccgagc cgtggcggat cgcggtgctg ctgggcaacc ggcaggccct caaggaggag       840
     caccagcagc agctgcagcg ggtggcgcgc aacgggctgg cgtgcggcat ccagctgttc       900
     atcgtcgaca tcccgatcac ggtgaactcg ccggtggaga ccgtgcgggt ggcggcggac       960
     cacacggcga cctgcaccat gaccggcaag cacgtgcggg tgctgctgga cccgccgctg      1020
     ccgcgccacg cggtgccgag ggcgtgcgcg gcgatcgcgg agaagcgcga ggagcggcgc      1080
     agccggttcg gcacgttcgc ggacctgctg cccgaggagc cgtggcagga gcggtcggcg      1140
     gcgggcgtgg tggccccggt ggggttcttc gacggcgacc cggtgccggt ggcgctgggc      1200
     gacacctcgc cgcacgcgct gatcggcggg ccgagcgggt cgggcaagac gaacctgctg      1260
     tacgcgatgc tgggcagcct cgcggccagg tactcgccgg acgagctgga gctgtacctg      1320
     ctggacttca aggagggcgt gtcgttcgcg cagttcgcgc cgggccgcaa ggacccgagc      1380
     tggctgccgc acgcccggct ggtcggggtg aacgtgaaca ccgaccgcga gttcggggtg      1440
     gcgctgctgc ggttcctggc cgacgagatg cggcggcggg cggacgcggc gaagcggcac      1500
     gaggtcacga agctggagca gctgcgcgag gaggacccgg aggggcggtg gcccagggtc      1560
     gtcgcggtga tcgacgagtt ccagtacctg ttcggggagc gcgaccaggt gaccgcgcag      1620
     gccacgcagc tgctggagga cgtggcgcgg cgcgggcggt cgcagggcat ccacctggtg      1680
     ctgtcgagcc aggacgtggc gggcatcgag gggttctggg gcaagtcggc gatcttcgag      1740
     cagttcaccg tgcggatcgc gctgccgaag gcgcggcggg tgctggcgga gccgcagaac      1800
     gacgcggcgg tggagctgcc gcgctggcac gcggtggtga accacgagtc gggggtgcgg      1860
     ccgggcaacc gggtggcgcg ggtgccggac gcgacgaagc ggggcacgtt cgacgcgctg      1920
     caggccgagc tgcaccggat gaggccggag gagctgccgg agccgatcct gttcgacggc      1980
     agccgggtgc cggtgctggg cgggctggcg gacttccagg cgctgcggcc gggcgaggcg      2040
     agcccgacgg tgctgctggg gcaggtgatc gacgtggccg ggagcgcggc gaaggtgcgg      2100
     ttcgcgcgga cgccggggcg gaacacggcg gtgatcgggt cgatggcgga ggacgcggcc      2160
     ggggtgctgg ccggtgcggc gctgtcgctg gcgcggcagc acttcgaggg tggggcgagg      2220
     ttcacggtgg cgtgcctggt ggacgacgcg aggccgcacg cggaccggct ggtcaagcgg      2280
     ctgcggggcc aggggttcga ggtcgccgag gtgccgctga aggacttccg cgaggtgccg      2340
     gaggacgagc gccgggggtt ccgcgaggtc gtggacgagc acgcgaagcg gttgcgggag      2400
     atcaacgcgg ggacgttcga gggcgacgtg gtcccggagt acctggtggt ctacggggtc      2460
     gacgcggcgc agagcctgct cgaggtcaag gacgagaaga cccgcgcgac cggcgtggac      2520
     agcttccggc tgctgctcaa gcacgggccg gagaaccgga cgcacctgct cggctggtgg      2580
     cgcggggcgc agcggctgaa gaacagcctg ccgcccggcg tgtacgacga catcggctcg      2640
     tggatcgcgt tcgacgtgca gggcaaggag ctgctctcgt tcggcccgga gcaggtgatg      2700
     tcctggtcgc cgagaccccg cagggggttg ttcttcgacc ggttcgagca ctcgcgcccg      2760
     caggtggtca tcccgttcga cacgggggag gaatcatga                             2799
//

If you have problems or comments...

PBIL Back to PBIL home page